RAB31 Polyclonal antibody

• 

  WB analysis using 15485-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15485-1-AP (RAB31 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 15485-1-AP

  WB result of RAB31 antibody (15485-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-RAB31 transfected HeLa cells.

• 

  WB analysis using 15485-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15485-1-AP (RAB31 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 15485-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 15485-1-AP (RAB31 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 15485-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 15485-1-AP (RAB31 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of K-562 using 15485-1-AP

  IP result of anti-RAB31 (IP:15485-1-AP, 4ug; Detection:15485-1-AP 1:1000) with K-562 cells lysate 1640 ug.

• 

  IHC staining of human liver cancer using 15485-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15485-1-AP (RAB31 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 15485-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15485-1-AP (RAB31 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 15485-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 15485-1-AP (RAB31 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

RAB31 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 15485-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, IP, ELISA

Synonyms

RAB22B, Ras related protein Rab 31, Ras-related protein Rab-22B, Ras-related protein Rab-31

---

Tested Applications

• Positive WB detected in: HeLa cells, human placenta tissue, HepG2 cells, K-562 cells
• Positive IP detected in: K-562 cells
• Positive IHC detected in: human liver cancer tissue, human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 1 publications below

Product Information

15485-1-AP targets RAB31 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7833

  Product name: Recombinant human RAB31 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-195 aa of BC001148

  Sequence: MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC

• Full Name: RAB31, member RAS oncogene family
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC001148
• Gene Symbol: RAB31
• Gene ID (NCBI): 11031
• RRID: AB_2176911
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13636
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAB31, also named as RAB22b, belongs to small GTP-binding proteins of the RAB family. Rab31 localizes in the trans-Golgi network (TGN) and endosomes. It is required for transport of mannose 6-phosphate receptors (MPRs) from the trans-Golgi network (TGN) to endosomes.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Transl Med; From Bowen disease to cutaneous squamous cell carcinoma: eight markers were verified from transcriptomic and proteomic analyses; Authors - Tang Biao
human	WB,IF	J Extracell Biol; RAB31 drives extracellular vesicle fusion and cancer-associated fibroblast formation leading to oxaliplatin resistance in colorectal cancer; Authors - Yu-Chan Chang