RAB32 Polyclonal antibody

• 

  WB analysis using 10999-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10999-1-AP (RAB32 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 10999-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10999-1-AP (RAB32 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human colon using 10999-1-AP

  human colon tissue were subjected to SDS PAGE followed by western blot with 10999-1-AP (RAB32 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293T using 10999-1-AP

  IP result of anti-RAB32 (IP:10999-1-AP, 4ug; Detection:10999-1-AP 1:500) with HEK-293T cells lysate 1560 ug.

• 

  IHC staining of human colon using 10999-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 10999-1-AP (RAB32 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 10999-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 10999-1-AP (RAB32 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 10999-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 10999-1-AP (RAB32 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 10999-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 10999-1-AP (RAB32 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U-251 using 10999-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U-251 cells using RAB32 antibody (10999-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

RAB32 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10999-1-AP

Publications(3)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

Ras-related protein Rab-32, Ras related protein Rab 32

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HeLa cells, human colon tissue, HepG2 cells
• Positive IP detected in: HEK-293T cells
• Positive IHC detected in: human colon tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 3 publications below
• IHC: See 1 publications below
• IF: See 2 publications below
• CoIP: See 1 publications below

Product Information

10999-1-AP targets RAB32 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1450

  Product name: Recombinant human RAB32 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-225 aa of BC015061

  Sequence: MAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC

• Full Name: RAB32, member RAS oncogene family
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 25-28 kDa
• GenBank Accession Number: BC015061
• Gene Symbol: RAB32
• Gene ID (NCBI): 10981
• RRID: AB_2177047
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13637
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IHC,IF	Cell Death Dis; Rab32 promotes glioblastoma migration and invasion via regulation of ERK/Drp1-mediated mitochondrial fission; Authors - Pin Chen ; KD Validated
mouse	WB,IF	mSphere; Burkholderia pseudomallei BopE suppresses the Rab32-dependent defense pathway to promote its intracellular replication and virulence; Authors - Chenglong Rao ; KD Validated
human,mouse	WB,CoIP	J Cell Biol; LYSMD proteins promote activation of Rab32-family GTPases for lysosome-related organelle biogenesis; Authors - Jinglin Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

deng (Verified Customer) (01-31-2025)

The antibody detects human endogenous Rab32.

• Applications: Western Blot, Immunofluorescence
• Primary Antibody Dilution: 1:1000 dilution for WB, and 1: 250 dilution for IF
• Cell Tissue Type: Mouse brain injected with human AAV-Rab32, human RPE1 cells

RAB32 Antibody Western Blot,Immunofluorescence validation (1:1000 dilution for WB, and 1: 250 dilution for IF dilution) in Mouse brain injected with human AAV-Rab32, human RPE1 cells (Cat no:10999-1-AP)