RAB32 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82960-1-RR (same clone as 82960-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82960-1-RR (RAB32 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82960-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 82960-1-RR (same clone as 82960-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using RAB32 antibody (82960-1-RR, Clone: 230315A9 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 82960-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 82960-1-RR (same clone as 82960-1-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug Anti-Human RAB32 (82960-1-RR, Clone:230315A9) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 82960-1-PBS in a different storage buffer formulation.

• 

  FC experiment of U-251 using 82960-1-RR (same clone as 82960-1-PBS)

  1x10^6 U-251 cells were intracellularly stained with 0.25 ug Anti-Human RAB32 (82960-1-RR, Clone:230315A9) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 82960-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82960-1-RR

  Biolayer interferometry (BLl) kinetic assays of 82960-1-RR against Human RAB32 were performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

RAB32 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 82960-1-PBS

Clone No.230315A9

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

230315A9, Ras related protein Rab 32, Ras-related protein Rab-32

---

Product Information

82960-1-PBS targets RAB32 in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1450

  Product name: Recombinant human RAB32 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-225 aa of BC015061

  Sequence: MAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC

• Full Name: RAB32, member RAS oncogene family
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 25-28 kDa
• GenBank Accession Number: BC015061
• Gene Symbol: RAB32
• Gene ID (NCBI): 10981
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13637
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Rab32 belongs to the Ras-like small GTPase superfamily, which regulate membrane dynamics, including membrane fusion/fission, exocytosis, and cytoskeletal trafficking. Rab32 anchors the type II regulatory subunit of protein kinase A to the mitochondrion and aids in mitochondrial fission. TRab32 also appears to be involved in autophagy and melanosome secretion.