RAB33A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RAB33A Polyclonal antibody (11025-1-AP)

RAB33A Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11025-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Small GTP-binding protein S10, Small GTP binding protein S10, Ras-related protein Rab-33A, Ras related protein Rab 33A, RABS10

• 

  WB analysis of mouse brain using 11025-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 11025-1-AP (RAB33A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 11025-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 11025-1-AP (RAB33A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 11025-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 11025-1-AP (RAB33A antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 11025-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 11025-1-AP (RAB33A antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 11025-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas using 11025-1-AP (RAB33A antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lymphoma using 11025-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma using 11025-1-AP (RAB33A antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of PC-12 using 11025-1-AP

  Immunofluorescent analysis of (4% PFA) fixed PC-12 cells using RAB33A antibody (11025-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RAB33A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, human brain tissue
• Positive IHC detected in: human brain tissue, human gliomas tissue, human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-12 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11025-1-AP targets RAB33A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1492

  Product name: Recombinant human RAB33A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-237 aa of BC009996

  Sequence: MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPC

• Full Name: RAB33A, member RAS oncogene family
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC009996
• Gene Symbol: RAB33A
• Gene ID (NCBI): 9363
• RRID: AB_2238178
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14088
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The RAB33A Polyclonal antibody (Cat# 11025-1-AP) has a total of 1 citation. The cited publication appeared in Biochemical and Biophysical Research Communications (2015), investigating the role of the small GTPase Rab33A in regulating amylase release from parotid acinar cells. The research field encompasses cell signaling, GTPase-mediated vesicular trafficking, and salivary gland physiology. The antibody was validated by Western blot and immunofluorescence in rat samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB, IF	Biochem Biophys Res Commun; The small GTPase Rab33A participates in regulation of amylase release from parotid acinar cells.; Authors - Akane Imai