RAB33A Monoclonal antibody, PBS Only

RAB33A Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 68389-1-PBS
Clone No.1C7F11

Host / Isotype

Mouse / IgG1

Reactivity

Human, rat, mouse, pig, rabbit

Applications

WB, IF/ICC, Indirect ELISA

RAB33A, RabS10, Ras related protein Rab 33A, Small GTP binding protein S10

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68389-1-PBS targets RAB33A in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human, rat, mouse, pig, rabbit samples.

Tested Reactivity Human, rat, mouse, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag33188

Product name: Recombinant human RAB33A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-237 aa of BC009996

Sequence: MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPC

Predict reactive species
Full Name RAB33A, member RAS oncogene family
Calculated Molecular Weight 27 kDa
GenBank Accession NumberBC009996
Gene Symbol RAB33A
Gene ID (NCBI) 9363
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ14088
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Ras-related protein Rab-33A (RAB33A) is also named as RABS10, and belongs to the small GTPase superfamily and the Rab family. RAB33A is an X-linked gene that is expressed in brain, lymphocytes, and normal melanocytes, but is downregulated in melanoma cells. In the brain, RAB33A is present throughout the cortex, as well as in the hippocampal CA fields (PMID:16810302). RAB33A is expressed in cells, including neurons, lymphocytes, melanocytes and parotid acinar cells (PMID:16810302, PMID:25871792). In cultured rat hippocampal neurons, RAB33A is localized to the Golgi apparatus and post-Golgi vesicles transported along axons (PMID:22972995).In addition, RAB33A interacts with singar1/RUFY3, which suppresses the formation of surplus axons in cultured hippocampal neurons (PMID:21737958, PMID:17439943).

Loading...
||
New chat Able
正在加载,请稍候...