RAB33B Polyclonal antibody

• 

  WB analysis of HeLa using 27349-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 27349-1-AP (RAB33B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27349-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 27349-1-AP (RAB33B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 27349-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 27349-1-AP (RAB33B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 27349-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 27349-1-AP (RAB33B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach using 27349-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 27349-1-AP (RAB33B antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach using 27349-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 27349-1-AP (RAB33B antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

RAB33B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27349-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Ras-related protein Rab-33B, Ras related protein Rab 33B

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, U-87 MG cells, HEK-293 cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

27349-1-AP targets RAB33B in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24181

  Product name: Recombinant human RAB33B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 39-229 aa of BC036064

  Sequence: IGDSNVGKTCLTYRFCAGRFPDHTEATIGVDFRERAVEIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLMLSQPPDNGIILKPEPKPAMTCWC

• Full Name: RAB33B, member RAS oncogene family
• Calculated Molecular Weight: 229 aa, 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC036064
• Gene Symbol: RAB33B
• Gene ID (NCBI): 83452
• RRID: AB_2880851
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H082
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAB33B is a small GTP-binding protein of the Rab GTPase family, whose members function in vesicle transport during protein secretion and endocytosis. Rab GTPases are active, membrane-associated proteins that recruit effector proteins in the GTP-bound state and inactive cytosolic proteins when in a GDP-bound state. RAB33B is ubiquitously expressed and has been implicated in Golgi to endoplasmic reticulum cycling of Golgi enzymes. In addition, RAB33B regulates Golgi homeostasis and coordinates intra-Golgi retrograde trafficking.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	PLoS Pathog; Legionella hijacks the host Golgi-to-ER retrograde pathway for the association of Legionella-containing vacuole with the ER.; Authors - Mio Kawabata