Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

RAB35 Polyclonal antibody

RAB35 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11329-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Ras-related protein Rab-1C, Ras related protein Rab 35, Ras related protein Rab 1C, RAB1C, GTP-binding protein RAY

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, A375 cells, human brain tissue, HeLa cells, MCF-7 cells, RAW 264.7 cells, mouse brain tissue, rat brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman breast cancer tissue, human liver tissue, human brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU-87 MG cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11329-2-AP targets RAB35 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, canine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1872

Product name: Recombinant human RAB35 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-201 aa of BC015931

Sequence: MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC

Predict reactive species
Full Name RAB35, member RAS oncogene family
Calculated Molecular Weight 201 aa, 23 kDa
Observed Molecular Weight 23 kDa
GenBank Accession NumberBC015931
Gene Symbol RAB35
Gene ID (NCBI) 11021
RRIDAB_2238179
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15286
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAB35 is a member of the small GTPase superfamily. Like the other Rab proteins, RAB35 has 2 consecutive cysteine residues at its C terminus, and this region is thought to be involved in membrane association. Rab35 is found on the cell surface and endosomes, where it has been proposed to play a role in recycling of the transferrin and other receptors.

Protocols

Product Specific Protocols
IF protocol for RAB35 antibody 11329-2-APDownload protocol
IHC protocol for RAB35 antibody 11329-2-APDownload protocol
IP protocol for RAB35 antibody 11329-2-APDownload protocol
WB protocol for RAB35 antibody 11329-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Science

Identification of an oncogenic RAB protein.

Authors - Douglas B Wheeler
  • KD Validated
humanWB

Cell Metab

Oligodendrocytes Provide Antioxidant Defense Function for Neurons by Secreting Ferritin Heavy Chain.

Authors - Chaitali Mukherjee
humanWB

Nat Cell Biol

An ARF6-Exportin-5 axis delivers pre-miRNA cargo to tumour microvesicles.

Authors - James W Clancy
humanWB

Nat Cell Biol

Protein kinase N controls a lysosomal lipid switch to facilitate nutrient signalling via mTORC1.

Authors - Alexander Wallroth
mouseWB,IF

Sci Adv

LRRK2 mediates tubulation and vesicle sorting from lysosomes.

Authors - Luis Bonet-Ponce
human,mouseWB,IHC,IF,CoIP

Nat Commun

A RAB35-p85/PI3K axis controls oscillatory apical protrusions required for efficient chemotactic migration.

Authors - Corallino Salvatore
  • KD Validated

Reviews

    5.0 out of 5
Add a review

3 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Xin (Verified Customer) (03-15-2022)

A clean antibody to probe Rab35 with the right MW.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: human postmortem brain lysate
RAB35 Antibody Western Blot validation (1:2000 dilution) in human postmortem brain lysate (Cat no:11329-2-AP)

Tom (Verified Customer) (02-24-2021)

HEK293T whole cell lysate probed with Rab35 antibody overnight at 4 degrees. Membrane was blocked in 5% BSA for one hour prior to incubation with antibody.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: HEK293T
RAB35 Antibody Western Blot validation (1:2000 dilution) in HEK293T (Cat no:11329-2-AP)

Mayur (Verified Customer) (01-14-2019)

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse brain tissue (Cortex)
RAB35 Antibody Western Blot, validation (1:1000 dilution) in Mouse brain tissue (Cortex) (Cat no:11329-2-AP)
Loading...
||
New chat

Able

正在加载,请稍候...