Featured Product
KD/KO Validated

RAB39 Polyclonal antibody

RAB39 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 13355-1-AP

Publications (4)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

Rab 39, Rab-39, RAB39A, Ras related protein Rab 39A, Ras-related protein Rab-39A

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHC

WB analysis of mouse brain using 13355-1-AP
mouse brain tissue were subjected to SDS PAGE followed by western blot with 13355-1-AP (RAB39 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human brain using 13355-1-AP
human brain tissue were subjected to SDS PAGE followed by western blot with 13355-1-AP (RAB39 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of mouse brain using 13355-1-AP
IP result of anti-RAB39 (IP:13355-1-AP, 4ug; Detection:13355-1-AP 1:500) with mouse brain tissue lysate 4000ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human gliomas using 13355-1-AP
Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 13355-1-AP (RAB39 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human gliomas using 13355-1-AP
Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 13355-1-AP (RAB39 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human gliomas using 13355-1-AP
Immunohistochemical analysis of paraffin-embedded human gliomas using 13355-1-AP (RAB39 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human gliomas using 13355-1-AP
Immunohistochemical analysis of paraffin-embedded human gliomas using 13355-1-AP (RAB39 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human brain using 13355-1-AP
Immunohistochemical analysis of paraffin-embedded human brain using 13355-1-AP (RAB39 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human brain using 13355-1-AP
Immunohistochemical analysis of paraffin-embedded human brain using 13355-1-AP (RAB39 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human brain using 13355-1-AP
Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 13355-1-AP (RAB39 Antibody) at dilution of 1:200 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human brain using 13355-1-AP
Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 13355-1-AP (RAB39 Antibody) at dilution of 1:200 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RAB39 in ?

Overview

Tested Applications
Product Information
Publications (4)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse brain tissue, human brain tissue
Positive IP detected in	mouse brain tissue
Positive IHC detected in	human gliomas tissue, human brain tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:4000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13355-1-AP targets RAB39 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	human, canine
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag4151 Product name: Recombinant human RAB39 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-217 aa of BC028064 Sequence: METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMYVQPFRIVFLLVGHKCDLASQRQVTREEAEKLSADCGMKYIETSAKDATNVEESFTILTRDIYELIKKGEICIQDGWEGVKSGFVPNTVHSSEEAVKPRKECFC Predict reactive species
Full Name	RAB39, member RAS oncogene family
Calculated Molecular Weight	217 aa, 25 kDa
Observed Molecular Weight	25 kDa
GenBank Accession Number	BC028064
Gene Symbol	RAB39
Gene ID (NCBI)	54734
RRID	AB_2284908
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q14964
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for RAB39 antibody 13355-1-AP	Download protocol
IP protocol for RAB39 antibody 13355-1-AP	Download protocol
WB protocol for RAB39 antibody 13355-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-RAB39A antibody (Cat# 13355-1-AP) has 4 total citations. These appear in Nature Communications, Cell Reports, Oncotarget, and Journal of Biochemistry. The associated research fields include autophagy and membrane tethering, exosome release from polarized epithelial cells, cancer development and stemness, and Rab GTPase signaling. Applications cited include Western blotting, immunoprecipitation, and immunofluorescence in human and canine samples.

Species	Application	Title
human	WB	Nat Commun C9orf72-catalyzed GTP loading of Rab39A enables HOPS-mediated membrane tethering and fusion in mammalian autophagy Authors - Shen Zhang KD Validated View Article
canine	WB,IP	Cell Rep Rab39 and its effector UACA regulate basolateral exosome release from polarized epithelial cells. Authors - Takahide Matsui View Article
human	WB	Oncotarget Prominent role of RAB39A-RXRB axis in cancer development and stemness. Authors - Tokuhiro Chano View Article
human	IF	J Biochem RAB39A: a Rab small GTPase with a prominent role in cancer stemness. Authors - Tokuhiro Chano View Article