Tested Applications
| Positive WB detected in | mouse brain tissue, human brain tissue, Y79 cells, fetal human brain tissue |
| Positive IP detected in | SH-SY5Y cells, mouse brain tissue |
| Positive IHC detected in | human lymphoma tissue, mouse small intestine tissue, human placenta tissue, mouse liver tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12162-1-AP targets RAB39B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2803 Product name: Recombinant human RAB39B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-213 aa of BC009714 Sequence: MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERRCLC Predict reactive species |
| Full Name | RAB39B, member RAS oncogene family |
| Calculated Molecular Weight | 213 aa, 25 kDa |
| Observed Molecular Weight | 25 kDa |
| GenBank Accession Number | BC009714 |
| Gene Symbol | RAB39B |
| Gene ID (NCBI) | 116442 |
| RRID | AB_2177360 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96DA2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for RAB39B antibody 12162-1-AP | Download protocol |
| IP protocol for RAB39B antibody 12162-1-AP | Download protocol |
| WB protocol for RAB39B antibody 12162-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RAB39B Polyclonal antibody (Cat# 12162-1-AP) has 14 citations. These appear in journals including Nature Communications, EMBO Journal, Oncogene, American Journal of Human Genetics, Movement Disorders, Brain Pathology, Molecular Brain, and Frontiers in Cell and Developmental Biology. Research fields span autophagy, Parkinson's disease, neurodegeneration, intellectual disability, synaptic function, and oncology (ovarian cancer, acute myeloid leukemia). Applications are predominantly Western blot, with immunofluorescence and immunoprecipitation also represented.
| Species | Application | Title |
|---|---|---|
Nat Commun C9orf72-catalyzed GTP loading of Rab39A enables HOPS-mediated membrane tethering and fusion in mammalian autophagy
| ||
J Nanobiotechnology Atosiban-conjugated 3WJ-pRNA nanoparticles delivering GAS1-enhanced extracellular vesicles: targeting the decidua to combat recurrent miscarriage.
| ||
Oncogene USP33 facilitates the ovarian cancer progression via deubiquitinating and stabilizing CBX2 | ||
EMBO J Loss of C9ORF72 impairs autophagy and synergizes with polyQ Ataxin-2 to induce motor neuron dysfunction and cell death. | ||
Am J Hum Genet Mutations in RAB39B Cause X-Linked Intellectual Disability and Early-Onset Parkinson Disease with α-Synuclein Pathology. |
Reviews
What customers say
The single review rates the antibody 4 out of 5 stars for Western Blot on human brain tissue. The reviewer reports that it performs well in membrane-enriched fractions from human brain homogenate at a 1:1000 dilution, producing clear specific bands. However, they note that several higher molecular weight bands appear when using crude lysates from the same samples, suggesting the antibody may show additional non-specific signals in less purified preparations. Overall, the antibody is considered effective for its intended application in enriched membrane fractions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
David (Verified Customer) (09-25-2019) | The antibodiy works well in membrane enriched fractionates generated from human brain homogenate. Note that several higher molecular weight bands are seen when using crude lysates generated from the same samples.Image details: lane 1 = molecular weight ladder, lanes 2-7 = membrane enriched fractionates (2µg/lane).Membrane blocked in 5% milk powder containing TBST overnight at 4oC. Primary antibody: RAB39B (1:1000) in 5% BSA containing TBST, 1hr incubation at RT. Secondar antibody: y Goat anti Rabbit-HRP (1:5000, 1hr RT) in 5% milk powder containing TBST.
 |
