RAB3A Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• RAB3A Recombinant monoclonal antibody, PBS Only (87642-2-PBS)

RAB3A Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87642-2-PBS

Clone No.253076D12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Ras related protein Rab 3A, Ras-related protein Rab-3A

• 

  WB analysis using 87642-2-RR (same clone as 87642-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87642-2-RR (RAB3A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87642-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87642-2-PBS targets RAB3A in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5438

  Product name: Recombinant human RAB3A protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 1-220 aa of NM_002866.4

  Sequence: MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC

• Full Name: RAB3A, member RAS oncogene family
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: NM_002866.4
• Gene Symbol: RAB3A
• Gene ID (NCBI): 5864
• RRID: AB_3745671
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P20336
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Rab3A is a small G-protein of the Rab family, that is implicated in vesicle fusion and regulated secretion, particularly in neurotransmitter release. Rab3 subfamily small G proteins (Rab3A, Rab3B, Rab3C, and Rab3D) control the regulated exocytosis in neuronal/secretory cells. Rab3A is the most abundant Rab GTPase in brain, where it is associated with synaptic vesicles. Rab3A is believed to modulate secretion efficiency by stimulating vesicle recruitment to sites of exocytosis and/ or by recruiting regulatory molecules to the docking/ fusion machinery.