• Featured Product
  • KD/KO Validated

RAB3D Polyclonal antibody

RAB3D Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 12320-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IP, IF, IHC, ELISA

D2 2, GOV, RAB16, RAB3D, RAD3D, Ras related protein Rab 3D

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse lung tissue, A549 cells, human cerebellum tissue, human stomach tissue, mouse spleen tissue, mouse stomach tissue, SW 1990 cells
Positive IP detected inSW 1990 cells
Positive IHC detected inhuman prostate cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2400
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:400-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12320-1-AP targets RAB3D in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, goat, pig, canine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2973

Product name: Recombinant human RAB3D protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-219 aa of BC016471

Sequence: MASAGDTQAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC

Predict reactive species
Full Name RAB3D, member RAS oncogene family
Calculated Molecular Weight 219 aa, 24 kDa
Observed Molecular Weight 28 kDa
GenBank Accession NumberBC016471
Gene Symbol RAB3D
Gene ID (NCBI) 9545
RRIDAB_2177228
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO95716
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Rab3D is a member of the Rab3 subfamily, which comprises four isoforms (Rab3A, Rab3B, Rab3C, and Rab3D). Rab3 proteins typically associate with secretory vesicles, including synaptic vesicles, and have been implicated in the control of regulated exocytosis. Rab3D is widely expressed in adipocytes, exocrine glands and several haematopoietic cells, where it localizes to secretory granules and vesicles.

Protocols

Product Specific Protocols
WB protocol for RAB3D antibody 12320-1-APDownload protocol
IHC protocol for RAB3D antibody 12320-1-APDownload protocol
IP protocol for RAB3D antibody 12320-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
pigWB

Mol Metab

Maternal hyperglycemia induces alterations in hepatic amino acid, glucose and lipid metabolism of neonatal offspring: Multi-omics insights from a diabetic pig model

Authors - Bachuki Shashikadze

Sci Signal

RhoA inhibits neural differentiation in murine stem cells through multiple mechanisms.

Authors - Junning Yang
humanIHC

Mol Cancer

Secretory RAB GTPase 3C modulates IL6-STAT3 pathway to promote colon cancer metastasis and is associated with poor prognosis.

Authors - Yu-Chan Chang
humanIHC

PLoS One

Accumulation of secretory vesicles in the lacrimal gland epithelia is related to non-Sjögren's type dry eye in visual display terminal users.

Authors - Mizuka Kamoi
mouseIF

Am J Physiol Gastrointest Liver Physiol

Establishment of novel in vitro mouse chief cell and SPEM cultures identifies MAL2 as a marker of metaplasia in the stomach.

Authors - Victoria G Weis
humanWB

Cancer Manag Res

The lncRNA HOXA11-AS regulates Rab3D expression by sponging miR-125a-5p promoting metastasis of osteosarcoma.

Authors - Kun Cao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Kamal (Verified Customer) (02-15-2024)

Rab3D antibody showed strong bands on western blot with fewer non-specific bands. This antibody was dilutedn1:2000 in 1X TBST.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Mouse liver tissue
FH

robert (Verified Customer) (06-13-2022)

This Rab3D antibody worked well for both immunoblotting and immunocytochemistry with gastric cancer cell lines. I tried others from other companies, but this antibody worked best.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: cell culture mkn45 and AGS cells
FH

Robert (Verified Customer) (01-24-2019)

This Rab3D antibody delivered a strong signal on Western Blots and fewer non-specific bands than other commercial Rab3D antibodies I've used. It was sensitive and specific. I may increase the dilution to 1:2000 and see how that works.

  • Applications: Western Blot, Immunofluorescence,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Gastric cell lines, pancreas
Loading...
||
New chat Able
正在加载,请稍候...