RAB3GAP2 Polyclonal antibody

RAB3GAP2 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 24599-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

KIAA0839, p150, Rab3 GAP p150, Rab3 GAP regulatory subunit, RAB3 GAP150, RAB3GAP150, RAB3GAP2, RGAP iso

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, Jurkat cells, mouse brain tissue
Positive IHC detected inhuman brain tissue, human cerebellum tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:8000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24599-1-AP targets RAB3GAP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20254

Product name: Recombinant human RAB3GAP2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-204 aa of BC146760

Sequence: MACSIVQFCYFQDLQAARDFLFPHLREEILSGALRRDPSKSTDWEDDGWGAWEENEPQEPEEEGNTCKTQKTSWLQDCVLSLSPTNDLMVIAREQKAVFLVPKWKYSDKGKEEMQFAVGWSGSLNVEEGECVTSALCIPLASQKRSSTGRPDWTCIVVGFTSGYVRFYTENGVLLLAQLLNEDPVLQLKCRTYEIPRHPGVTEQ

Predict reactive species
Full Name RAB3 GTPase activating protein subunit 2 (non-catalytic)
Calculated Molecular Weight 1393 aa, 156 kDa
Observed Molecular Weight 150 kDa
GenBank Accession NumberBC146760
Gene Symbol RAB3GAP2
Gene ID (NCBI) 25782
RRIDAB_2879632
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H2M9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAB3GAP2, also known as RAB3-GAP150, belongs to the Rab3-GAP regulatory subunit family. Rab3 GAP consists of two subunits: the catalytic subunit p130 and the noncatalytic subunit p150. Rab3 GAP is ubiquitously expressed and enriched in the synaptic soluble fraction of brain, consistent with it having a key role in neurodevelopment. RAB3-GAP150 forms the Rab3 GTPase-activating complex with RAB3-GAP130,where it constitutes the regulatory subunit, whereas the latter functions as the catalytic subunit. Defects in RAB3-GAP150 are the cause of Martsolf and Warburg Micro syndrome.

Protocols

Product Specific Protocols
WB protocol for RAB3GAP2 antibody 24599-1-APDownload protocol
IHC protocol for RAB3GAP2 antibody 24599-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

BING (Verified Customer) (08-04-2021)

A reliable Ab to probe RAB3GAP2 with the right MW of 150 kd.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: mouse brain and postmortembrain lysates
RAB3GAP2 Antibody Western Blot validation (1:5000 dilution) in mouse brain and postmortembrain lysates (Cat no:24599-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...