RAB3GAP2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RAB3GAP2 Polyclonal antibody (24599-1-AP)

• 

  WB analysis using 24599-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24599-1-AP (RAB3GAP2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

RAB3GAP2 Polyclonal Antibody for WB, ELISA

Cat No. 24599-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Rab3 GTPase-activating protein 150 kDa subunit, Rab3 GTPase-activating protein non-catalytic subunit, Rab3-GAP p150, Rab3-GAP regulatory subunit

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, Jurkat cells, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

24599-1-AP targets RAB3GAP2 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20254

  Product name: Recombinant human RAB3GAP2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-204 aa of BC146760

  Sequence: MACSIVQFCYFQDLQAARDFLFPHLREEILSGALRRDPSKSTDWEDDGWGAWEENEPQEPEEEGNTCKTQKTSWLQDCVLSLSPTNDLMVIAREQKAVFLVPKWKYSDKGKEEMQFAVGWSGSLNVEEGECVTSALCIPLASQKRSSTGRPDWTCIVVGFTSGYVRFYTENGVLLLAQLLNEDPVLQLKCRTYEIPRHPGVTEQ

• Full Name: RAB3 GTPase activating protein subunit 2 (non-catalytic)
• Calculated Molecular Weight: 1393 aa, 156 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC146760
• Gene Symbol: RAB3GAP2
• Gene ID (NCBI): 25782
• RRID: AB_2879632
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H2M9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAB3GAP2, also known as RAB3-GAP150, belongs to the Rab3-GAP regulatory subunit family. Rab3 GAP consists of two subunits: the catalytic subunit p130 and the noncatalytic subunit p150. Rab3 GAP is ubiquitously expressed and enriched in the synaptic soluble fraction of brain, consistent with it having a key role in neurodevelopment. RAB3-GAP150 forms the Rab3 GTPase-activating complex with RAB3-GAP130,where it constitutes the regulatory subunit, whereas the latter functions as the catalytic subunit. Defects in RAB3-GAP150 are the cause of Martsolf and Warburg Micro syndrome.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	Int J Biol Macromol; RAB3GAP2 silencing alleviates oxidative stress in cataracts by enhancing Mfn2-mediated mitochondrial autophagy by activating JNK/STAT3.; Authors - Yuanyuan Huang ; KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

BING (Verified Customer) (08-04-2021)

A reliable Ab to probe RAB3GAP2 with the right MW of 150 kd.

• Applications: Western Blot
• Primary Antibody Dilution: 1:5000
• Cell Tissue Type: mouse brain and postmortembrain lysates

RAB3GAP2 Antibody Western Blot validation (1:5000 dilution) in mouse brain and postmortembrain lysates (Cat no:24599-1-AP)