RAB43 Polyclonal antibody

• 

  WB analysis using 28240-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28240-1-AP (RAB43 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

RAB43 Polyclonal Antibody for WB, ELISA

Cat No. 28240-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

ISY1, RAB41, RAB43, Ras related protein Rab 41, Ras related protein Rab 43

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28240-1-AP targets RAB43 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26911

  Product name: Recombinant human RAB43 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 91-212 aa of BC062319

  Sequence: ANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGCGC

• Full Name: RAB43, member RAS oncogene family
• Calculated Molecular Weight: 212 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC062319
• Gene Symbol: RAB43
• Gene ID (NCBI): 339122
• RRID: AB_2881095
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86YS6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.