RAB43 Polyclonal antibody

RAB43 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28240-1-AP

Publications (1)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

ISY1, RAB11B, RAB41, Ras related protein Rab 41, Ras related protein Rab 43

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis using 28240-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 28240-1-AP (RAB43 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse kidney using 28240-1-AP
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 28240-1-AP (RAB43 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse kidney using 28240-1-AP
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 28240-1-AP (RAB43 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse liver using 28240-1-AP
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 28240-1-AP (RAB43 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat brain using 28240-1-AP
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 28240-1-AP (RAB43 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat kidney using 28240-1-AP
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 28240-1-AP (RAB43 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat brain using 28240-1-AP
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 28240-1-AP (RAB43 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RAB43 in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HEK-293 cells, HepG2 cells
Positive IHC detected in	mouse kidney tissue, mouse liver tissue, rat brain tissue, rat kidney tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28240-1-AP targets RAB43 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag26911 Product name: Recombinant human RAB43 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 91-212 aa of BC062319 Sequence: ANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGCGC Predict reactive species
Full Name	RAB43, member RAS oncogene family
Calculated Molecular Weight	212 aa, 23 kDa
Observed Molecular Weight	23 kDa
GenBank Accession Number	BC062319
Gene Symbol	RAB43
Gene ID (NCBI)	339122
RRID	AB_2881095
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q86YS6
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for RAB43 antibody 28240-1-AP	Download protocol
WB protocol for RAB43 antibody 28240-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The RAB43 Polyclonal antibody (Cat# 28240-1-AP) has 1 total citation. It appears in Gynecological Endocrinology (2025), in a study investigating how circRNA_BMPR2 regulates Rab43 expression to affect polycystic ovary syndrome progression. The research field is reproductive endocrinology and gynecology, with the antibody applied in Western blot on human samples.

Species	Application	Title
human	WB	Gynecol Endocrinol circRNA_BMPR2 affects the progression of polycystic ovary syndrome by regulating the expression of Rab43 Authors - Wang Liping View Article