Tested Applications
| Positive WB detected in | HEK-293 cells, HepG2 cells |
| Positive IHC detected in | mouse kidney tissue, mouse liver tissue, rat brain tissue, rat kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28240-1-AP targets RAB43 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26911 Product name: Recombinant human RAB43 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 91-212 aa of BC062319 Sequence: ANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGCGC Predict reactive species |
| Full Name | RAB43, member RAS oncogene family |
| Calculated Molecular Weight | 212 aa, 23 kDa |
| Observed Molecular Weight | 23 kDa |
| GenBank Accession Number | BC062319 |
| Gene Symbol | RAB43 |
| Gene ID (NCBI) | 339122 |
| RRID | AB_2881095 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q86YS6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for RAB43 antibody 28240-1-AP | Download protocol |
| WB protocol for RAB43 antibody 28240-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RAB43 Polyclonal antibody (Cat# 28240-1-AP) has 1 total citation. It appears in Gynecological Endocrinology (2025), in a study investigating how circRNA_BMPR2 regulates Rab43 expression to affect polycystic ovary syndrome progression. The research field is reproductive endocrinology and gynecology, with the antibody applied in Western blot on human samples.
| Species | Application | Title |
|---|---|---|
Gynecol Endocrinol circRNA_BMPR2 affects the progression of polycystic ovary syndrome by regulating the expression of Rab43 |













