RAB44 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RAB44 Polyclonal antibody (31195-1-AP)

• 

  WB analysis using 31195-1-AP

  THP1 cells were subjected to SDS PAGE followed by western blot with 31195-1-AP (RAB44 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

RAB44 Polyclonal Antibody for WB, ELISA

Cat No. 31195-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

RASL13, RASD3

---

Tested Applications

• Positive WB detected in: THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31195-1-AP targets RAB44 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35126

  Product name: Recombinant human RAB44 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of NM_001257357

  Sequence: METGQRTSRKVRKLGSNRRRQTREPADGEGAAVAPEPESWSSQAAAELQAFFQDCGAKERGFVTREDLAVAKFSFLGSKEESEMIFDWVDVERKGHLSLEEFSSGLKNIFGSSQSPHRLRRRKPLPSKRVSATTSFPALEEADAEEKEAF

• Full Name: RAB44, member RAS oncogene family
• Calculated Molecular Weight: 111 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: NM_001257357
• Gene Symbol: RAB44
• Gene ID (NCBI): 401258
• RRID: AB_3669894
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q7Z6P3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Rab44 is a member of the large Rab GTPase family, encoding an N-terminal EF-hand domain, a coiled-coil domain and a C-terminal Rab GTPase domain. It is highly expressed in immune-related cells such as mast cells, macrophages, osteoclasts and granulocyte lineage cells in the bone marrow. In mouse mast cells, Rab44 is expressed as two isoforms, the long and short forms with molecular masses of 180 kDa and 110 kDa (PMID: 33641252).