RAB5B Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• RAB5B Recombinant monoclonal antibody (86951-1-RR)

RAB5B Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86951-1-RR

Clone No.252038B1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

EC:3.6.5.2, Ras related protein Rab 5B, Ras-related protein Rab-5B

• 

  WB analysis using 86951-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86951-1-RR (RAB5B antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 86951-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86951-1-RR (RAB5B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 86951-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86951-1-RR (RAB5B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 86951-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86951-1-RR (RAB5B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 86951-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86951-1-RR (RAB5B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 86951-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86951-1-RR (RAB5B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 86951-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86951-1-RR against Human RAB5B were performed. The affinity constant is 0.668 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HeLa cells, NIH/3T3 cells, rat lung tissue, Recombinant protein, mouse lung tissue, HEK-293 cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86951-1-RR targets RAB5B in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5609

  Product name: Recombinant human RAB5B protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 1-215 aa of NM_001252036.2

  Sequence: MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN

• Full Name: RAB5B, member RAS oncogene family
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 24-27 kDa
• GenBank Accession Number: NM_001252036.2
• Gene Symbol: RAB5B
• Gene ID (NCBI): 5869
• RRID: AB_3745229
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P61020-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAB5B (Ras-related protein Rab-5B) belongs to the Rab family. Rab5 is specifically localized to the early compartment and regulates endocytosis (PMID:1516130, PMID:9087439). There are three isoforms of Rab5 namely, Rab5a, Rab5b, and Rab5c present in EE of mammalian cells (PMID:7789520). Recently, we have shown that Rab5a regulates fluid-phase endocytosis whereas receptor-mediated endocytosis is regulated by Rab5b in Leishmania (PMID:27226564).