Tested Applications
| Positive IP detected in | Caco-2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
33697-1-AP targets RAB5IF in IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag38730 Product name: Recombinant human C20orf24 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-44 aa of BC004446 Sequence: MSGGRRKEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEFLDV Predict reactive species |
| Full Name | chromosome 20 open reading frame 24 |
| Calculated Molecular Weight | 137 aa, 15 kDa |
| Observed Molecular Weight | 10-15 kDa |
| GenBank Accession Number | BC004446 |
| Gene Symbol | C20orf24 |
| Gene ID (NCBI) | 55969 |
| RRID | AB_3743053 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9BUV8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Human RAB5IF (RAB5-interacting protein) is a key effector protein of the Rab5 GTPase, primarily localized to early endosomes, where it serves as an essential functional and marker protein. By binding to activated Rab5, it participates in regulating processes such as endosome recognition, fusion, transport, and maturation, making it a core molecule in the study of clathrin-mediated endocytosis and vesicular transport. This protein plays a crucial role in maintaining endosomal dynamics and receptor sorting, while also influencing the spatiotemporal signaling of pathways such as those involving growth factor receptors. Studies suggest that functional abnormalities in RAB5IF may be associated with tumorigenesis and progression, yet its core research domains remain focused on organelle and subcellular labeling, cell biology, and intracellular signal transduction.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for RAB5IF antibody 33697-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

