RAB7B Polyclonal antibody

• 

  WB analysis of HEK-293 using 12283-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12283-1-AP (RAB7B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 12283-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 12283-1-AP (RAB7B antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 12283-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12283-1-AP (RAB7B antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

RAB7B Polyclonal Antibody for ELISA

Cat No. 12283-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF, ELISA

Synonyms

RAB7, RAB7B, Ras related protein Rab 7b

---

Published Applications

• WB: See 1 publications below
• IF: See 2 publications below

Product Information

12283-1-AP targets RAB7B in WB, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2936

  Product name: Recombinant human RAB7B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-199 aa of BC017092

  Sequence: MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQIWDTGGQERFRSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC

• Full Name: RAB7B, member RAS oncogene family
• Calculated Molecular Weight: 199 aa, 23 kDa
• GenBank Accession Number: BC017092
• Gene Symbol: RAB7B
• Gene ID (NCBI): 338382
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96AH8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	bioRxiv; Legionella pneumophila exploits the endo-lysosomal network for phagosome biogenesis by co-opting SUMOylated Rab7; Authors - Chuang Li
human	IF	Biochem Biophys Res Commun; Melanin-concentrating hormone receptor 1 is discarded by exosomes after internalization; Authors - Ryohei Yamada