RAB7B Polyclonal antibody

• 

  WB analysis using 12283-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12283-1-AP (RAB7B antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

RAB7B Polyclonal Antibody for WB, ELISA

Cat No. 12283-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IF, ELISA

Synonyms

RAB7, Ras related protein Rab 7b, Ras-related protein Rab-7b

---

Tested Applications

• Positive WB detected in: THP-1 cells, U-937 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 3 publications below

Product Information

12283-1-AP targets RAB7B in WB, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2936

  Product name: Recombinant human RAB7B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-199 aa of BC017092

  Sequence: MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQIWDTGGQERFRSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC

• Full Name: RAB7B, member RAS oncogene family
• Calculated Molecular Weight: 199 aa, 23 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC017092
• Gene Symbol: RAB7B
• Gene ID (NCBI): 338382
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96AH8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	bioRxiv; Legionella pneumophila exploits the endo-lysosomal network for phagosome biogenesis by co-opting SUMOylated Rab7; Authors - Chuang Li
human	IF	Biochem Biophys Res Commun; Melanin-concentrating hormone receptor 1 is discarded by exosomes after internalization; Authors - Ryohei Yamada
monkey	IF	J Virol; Nsp2 replicase-mediated viral uncoating in porcine alveolar macrophages contributes to the attenuation of PRRSV-2 live attenuated vaccine; Authors - Yuan-Zhe Bai