RAB7L1 Polyclonal antibody

• 

RAB7L1 Polyclonal Antibody for ELISA

Cat No. 10342-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

Rab 7 like protein 1, RAB7L, RAB7L1, Ras related protein Rab 7L1

---

Product Information

10342-1-AP targets RAB7L1 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0332

  Product name: Recombinant human RAB7L1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 19-203 aa of BC002585

  Sequence: GKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC

• Full Name: RAB7, member RAS oncogene family-like 1
• Calculated Molecular Weight: 23 kDa
• GenBank Accession Number: BC002585
• Gene Symbol: RAB7L1
• Gene ID (NCBI): 8934
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14966
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.