Product Information
86540-7-PBS targets RAB8A as part of a matched antibody pair:
MP02488-2: 86540-7-PBS capture and 86540-6-PBS detection (validated in Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag30567 Product name: Recombinant human RAB8A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 150-204 aa of NM_005370 Sequence: TSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRC Predict reactive species |
| Full Name | RAB8A, member RAS oncogene family |
| Calculated Molecular Weight | 24 kDa |
| GenBank Accession Number | NM_005370 |
| Gene Symbol | RAB8A |
| Gene ID (NCBI) | 4218 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P61006 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
