RABL2B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RABL2B Polyclonal antibody, PBS Only (11588-1-PBS)

• 

  WB analysis using 11588-1-AP (same clone as 11588-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11588-1-AP (RABL2B antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11588-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 11588-1-AP (same clone as 11588-1-PBS)

  WB result of RABL2B antibody (11588-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-RABL2B transfected HepG2 cells. This data was developed using the same antibody clone with 11588-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 11588-1-AP (same clone as 11588-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 11588-1-AP (RABL2B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11588-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human kidney using 11588-1-AP (same clone as 11588-1-PBS)

  human kidney tissue were subjected to SDS PAGE followed by western blot with 11588-1-AP (RABL2B antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11588-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 11588-1-AP (same clone as 11588-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 11588-1-AP (RABL2B antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11588-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 11588-1-AP (same clone as 11588-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 11588-1-AP (RABL2B antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11588-1-PBS in a different storage buffer formulation.

• 

  IP experiment of fetal human brain using 11588-1-AP (same clone as 11588-1-PBS)

  IP result of anti-RABL2B (IP:11588-1-AP, 4ug; Detection:11588-1-AP 1:300) with fetal human brain tissue lysate 4000 ug. This data was developed using the same antibody clone with 11588-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 11588-1-AP (same clone as 11588-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 11588-1-AP (RABL2B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11588-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 11588-1-AP (same clone as 11588-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 11588-1-AP (RABL2B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11588-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 11588-1-AP (same clone as 11588-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 11588-1-AP (RABL2B antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11588-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 11588-1-AP (same clone as 11588-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11588-1-AP (RABL2B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11588-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RABL2B Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 11588-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

Rab like protein 2B, Rab-like protein 2B

---

Product Information

11588-1-PBS targets RABL2B in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2189

  Product name: Recombinant human RABL2B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-229 aa of BC024281

  Sequence: MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGRTILVDFWDTAGQERFQSMHASYYHKAHACIMVFDVQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDADINVTQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQEQSSSIETPSEEAASPHS

• Full Name: RAB, member of RAS oncogene family-like 2B
• Calculated Molecular Weight: 229 aa, 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC024281
• Gene Symbol: RABL2B
• Gene ID (NCBI): 11158
• RRID: AB_2175954
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UNT1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Rab-like protein 2B (RABL2B) is a member of a poorly characterised clade of the RAS GTPase superfamily, which plays an essential role in male fertility, sperm intraflagellar transport and tail assembly (PMID: 28553998, PMID: 28138870). A preferential expression of RABL2B in human tissues and lymphoblastoid cell lines was detected which is most pronounced in brain and placenta (PMID: 20138207).