RABL2B Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83470-3-RR (same clone as 83470-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83470-3-RR (RABL2B antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83470-3-PBS in a different storage buffer formulation.

• 

  FC experiment of A549 using 83470-3-RR (same clone as 83470-3-PBS)

  1x10^6 A549 cells were intracellularly stained with 0.25 ug RABL2B Recombinant antibody (83470-3-RR, Clone:240501D3) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83470-3-PBS in a different storage buffer formulation.

• 

  FC experiment of MCF-7 using 83470-3-RR (same clone as 83470-3-PBS)

  1x10^6 MCF-7 cells were intracellularly stained with 0.25 ug RABL2B Recombinant antibody (83470-3-RR, Clone:240501D3) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83470-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83470-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83470-3-RR against Human RABL2B were performed. The affinity constant is 0.256 nM.

RABL2B Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 83470-3-PBS

Clone No.240501D3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

Synonyms

240501D3, Rab like protein 2B, Rab-like protein 2B

---

Product Information

83470-3-PBS targets RABL2B in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2189

  Product name: Recombinant human RABL2B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-229 aa of BC024281

  Sequence: MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGRTILVDFWDTAGQERFQSMHASYYHKAHACIMVFDVQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDADINVTQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQEQSSSIETPSEEAASPHS

• Full Name: RAB, member of RAS oncogene family-like 2B
• Calculated Molecular Weight: 229 aa, 26 kDa
• GenBank Accession Number: BC024281
• Gene Symbol: RABL2B
• Gene ID (NCBI): 11158
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9UNT1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.