• Featured Product
  • KD/KO Validated

RAC2 Monoclonal antibody

RAC2 Monoclonal Antibody for WB, IHC, ELISA
Cat No. 60077-1-Ig
Clone No.4C2H6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, coIP, ELISA

4C2H6, Gx, HSPC022, p21 Rac2, p21-Rac2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, MCF-7 cells, HSC-T6 cells, NIH/3T3 cells, RAW 264.7 cells
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:20000
Immunohistochemistry (IHC)IHC : 1:4000-1:16000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60077-1-Ig targets RAC2 in WB, IHC, IF, coIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1202

Product name: Recombinant human RAC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-192 aa of BC001485

Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL

Predict reactive species
Full Name ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
Calculated Molecular Weight 21 kDa
Observed Molecular Weight 21 kDa
GenBank Accession NumberBC001485
Gene Symbol RAC2
Gene ID (NCBI) 5880
RRIDAB_2253445
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP15153
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAC2, also named as GX, belongs to the small GTPase superfamily and Rho family. RAC2 is a plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as secretory processes, phagocytose of apoptotic cells and epithelial cell polarization. RAC2 augments the production of reactive oxygen species (ROS) by NADPH oxidase. Defects in RAC2 are the cause of neutrophil immunodeficiency syndrome.

Protocols

Product Specific Protocols
IHC protocol for RAC2 antibody 60077-1-IgDownload protocol
WB protocol for RAC2 antibody 60077-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratWB,coIP

ACS Nano

Oxidation of Reduced Graphene Oxide via Cellular Redox Signaling Modulates Actin-Mediated Neurotransmission.

Authors - Yiyuan Kang
mouseWB

J Exp Med

Chemokine-coupled β2 integrin-induced macrophage Rac2-Myosin IIA interaction regulates VEGF-A mRNA stability and arteriogenesis.

Authors - Alan R Morrison
  • KO Validated
mouseWB

Prog Neurobiol

A γ-adducin cleavage fragment induces neurite deficits and synaptic dysfunction in Alzheimer's disease.

Authors - Min Xiong
humanWB

Cell Mol Immunol

DOCK2 regulates antifungal immunity by regulating RAC GTPase activity.

Authors - Xiaojian Ma
mouseWB

Sci Signal

Rac signal adaptation controls neutrophil mobilization from the bone marrow.

Authors - Carlo Cosimo Campa
humanWB

Oncotarget

Upregulated long non-coding RNA AFAP1-AS1 expression is associated with progression and poor prognosis of nasopharyngeal carcinoma.

Authors - Hao Bo
Loading...
||
New chat Able
正在加载,请稍候...