RAD51L1 Polyclonal antibody

• 

  WB analysis of HeLa using 13555-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13555-1-AP (RAD51L1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

RAD51L1 Polyclonal Antibody for WB, ELISA

Cat No. 13555-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

hREC2, R51H2, RAD51 homolog B, RAD51 like 1 (S. cerevisiae), RAD51 like protein 1, RAD51B, RAD51L1, REC2

---

Tested Applications

• Positive WB detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

13555-1-AP targets RAD51L1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4412

  Product name: Recombinant human RAD51L1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-384 aa of BC030219

  Sequence: MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF

• Full Name: RAD51-like 1 (S. cerevisiae)
• Calculated Molecular Weight: 384 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC030219
• Gene Symbol: RAD51L1
• Gene ID (NCBI): 5890
• RRID: AB_10597851
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15315
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Cell Int; Identification of a RAD51B enhancer variant for susceptibility and progression to glioma; Authors - Liming Huang