RAD52 Monoclonal antibody

RAD52 Monoclonal Antibody for WB, ELISA
Cat No. 68283-1-Ig
Clone No.3H8G9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, ELISA

DNA repair protein RAD52 homolog, 3H8G9

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HL-60 cells, HSC-T6 cells, 4T1 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68283-1-Ig targets RAD52 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27665

Product name: Recombinant human RAD52 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 234-418 aa of NM_001297419

Sequence: MADQDCSSRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHSTPVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLALNNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS

Predict reactive species
Full Name RAD52 homolog (S. cerevisiae)
Calculated Molecular Weight 46 aa
Observed Molecular Weight46 kDa
GenBank Accession NumberNM_001297419
Gene Symbol RAD52
Gene ID (NCBI) 5893
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP43351
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

In Saccharomyces cerevisiae, Rad52 functions as a critical mediator of homologous recombination (HR) by facilitating the loading of Rad51 onto ssDNA. However, in mammalian systems and other vertebrates, BRCA2 is known to function as the primary mediator of RAD51 filament formation, while prior studies have shown a limited role for RAD52 in HR.Additionally, loss of RAD52 has little consequence for cell viability. Recent evidence suggests that RAD52 may provide an alternative mediator pathway to BRCA2 function (PMID: 34928169). Several studies have suggested a link between the functional regulation of RAD52 and the protein modification by a small ubiquitin-like modifier (SUMO), sumoylation may play an important role in the nuclear transport of RAD52 (PMID:20190268). The calculated MW of Rad52 is 46 kDa, 68283-1-Ig can detect the band around 46 kDa.

Loading...
||
New chat

Able

正在加载,请稍候...