RAD9B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RAD9B Polyclonal antibody (20154-1-AP)

• 

  WB analysis using 20154-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 20154-1-AP (RAD9B antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

RAD9B Polyclonal Antibody for WB, ELISA

Cat No. 20154-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

hRAD9B, RAD9 homolog B (S. pombe)

---

Tested Applications

• Positive WB detected in: HL-60 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20154-1-AP targets RAD9B in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14009

  Product name: Recombinant human RAD9B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 83-426 aa of BC068031

  Sequence: CKLGMKSILPIFRCLNSLERNIEKCRIFTRSDKCKVVIQFFYRHGIKRTHNICFQESQPLQVIFDKNVCTNTLMIQPRLLADAIVLFTSSQEEVTLAVTPLNFCLKSSNEESMDLSNAVHSEMFVGSDEFDFFQIGMDTEITFCFKELKGILTFSEATHAPISIYFDFPGKPLALSIDDMLVEANFILATLADEQSRASSPQSLCLSQKRKRSDLIEKKAGKNVTGQALECISKKAAPRRLYPKETLTNISALENCGSPAMKRVDGDVSEVSESSVSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEEDMNNVCCRKEFNGSDAKYFCII

• Full Name: RAD9 homolog B (S. pombe)
• Calculated Molecular Weight: 426 aa, 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC068031
• Gene Symbol: RAD9B
• Gene ID (NCBI): 144715
• RRID: AB_3741978
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6WBX8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAD9B is a key member of the DNA damage response and cell cycle checkpoint family. Homologous to RAD9A, it typically functions as a subunit of the 9-1-1 complex (RAD9B-RAD1-HUS1), which is loaded onto chromatin in response to DNA damage or replication stress. This complex activates the ATM/ATR kinase pathway to mediate cell cycle arrest, DNA repair, or apoptosis.