RALB Polyclonal antibody

• 

  WB analysis of Y79 using 12340-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 12340-1-AP (RALB Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 12340-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12340-1-AP (RALB antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human lung using 12340-1-AP

  human lung tissue were subjected to SDS PAGE followed by western blot with 12340-1-AP (RALB antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 12340-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 12340-1-AP (RALB Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 12340-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12340-1-AP (RALB Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Y79 using 12340-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 12340-1-AP (RALB antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary tumor using 12340-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 12340-1-AP (RALB antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 12340-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 12340-1-AP (RALB antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 12340-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 12340-1-AP (RALB antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human colon using 12340-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 12340-1-AP (RALB antibody) at dilution of 1:200 (under 40x lens).

RALB Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12340-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, ELISA

Synonyms

RALB, Ras related protein Ral B

---

Tested Applications

• Positive WB detected in: Y79 cells, human brain tissue, human lung tissue, mouse brain tissue, mouse lung tissue
• Positive IHC detected in: human ovary tumor tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 2 publications below

Product Information

12340-1-AP targets RALB in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, Drosophila
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2992

  Product name: Recombinant human RALB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-206 aa of BC018163

  Sequence: MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL

• Full Name: v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein)
• Calculated Molecular Weight: 206 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC018163
• Gene Symbol: RALB
• Gene ID (NCBI): 5899
• RRID: AB_2269253
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P11234
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
Drosophila	IHC	Development; Ral GTPase promotes asymmetric Notch activation in the Drosophila eye in response to Frizzled/PCP signaling by repressing ligand-independent receptor activation.; Authors - Cho Bomsoo B
human	WB	Front Chem; Design, Synthesis, and Biological Evaluation of Pyrano[2,3-c]-pyrazole-Based RalA Inhibitors Against Hepatocellular Carcinoma.; Authors - Yuting Wang
human	WB,IHC	Arch Biochem Biophys; MicroRNA-139 inhibits pancreatic-cancer carcinogenesis by suppressing RalB via the Ral/RAC/PI3K pathway.; Authors - Yan Wang