RALB Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RALB Polyclonal antibody (12340-1-AP)

RALB Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12340-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

RALB, Ras related protein Ral B

• 

  WB analysis of Y79 using 12340-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 12340-1-AP (RALB Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 12340-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 12340-1-AP (RALB Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 12340-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12340-1-AP (RALB Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 12340-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12340-1-AP (RALB antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human lung using 12340-1-AP

  human lung tissue were subjected to SDS PAGE followed by western blot with 12340-1-AP (RALB antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Y79 using 12340-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 12340-1-AP (RALB antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 12340-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 12340-1-AP (RALB antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 12340-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 12340-1-AP (RALB antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 12340-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 12340-1-AP (RALB antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 12340-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 12340-1-AP (RALB antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RALB in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Y79 cells, human brain tissue, human lung tissue, mouse brain tissue, mouse lung tissue
• Positive IHC detected in: human ovary tumor tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12340-1-AP targets RALB in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, drosophila
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2992

  Product name: Recombinant human RALB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-206 aa of BC018163

  Sequence: MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL

• Full Name: v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein)
• Calculated Molecular Weight: 206 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC018163
• Gene Symbol: RALB
• Gene ID (NCBI): 5899
• RRID: AB_2269253
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P11234
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The RALB Polyclonal antibody (Cat# 12340-1-AP) has 5 total citations. These appear in Frontiers in Chemistry, Development, Archives of Biochemistry and Biophysics, Life Science Alliance, and Human Cell. Research fields span hepatocellular carcinoma, Notch signaling in Drosophila eye development, pancreatic cancer, pancreatic disease and primary cilia biology, and rheumatic valvular heart disease. Applications cited include WB, IHC, and IF across human, mouse, and Drosophila species.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Chem; Design, Synthesis, and Biological Evaluation of Pyrano[2,3-c]-pyrazole-Based RalA Inhibitors Against Hepatocellular Carcinoma.; Authors - Yuting Wang
Drosophila	IHC	Development; Ral GTPase promotes asymmetric Notch activation in the Drosophila eye in response to Frizzled/PCP signaling by repressing ligand-independent receptor activation.; Authors - Cho Bomsoo B
human	WB,IHC	Arch Biochem Biophys; MicroRNA-139 inhibits pancreatic-cancer carcinogenesis by suppressing RalB via the Ral/RAC/PI3K pathway.; Authors - Yan Wang
mouse	WB,IF	Life Sci Alliance; RalGAP complexes control secretion and primary cilia in pancreatic disease; Authors - Lisa H Apken
human	WB	Hum Cell; Hsa_circ_0000437 promotes the progression of rheumatic valvular heart disease by activating the mitogen-activated protein kinase signaling pathways after sponging let-7f-5p and targeting RAS-like proto-oncogene B.; Authors - Linwen Zhu