RALBP1 Monoclonal antibody, PBS Only

• 

  WB analysis of NIH/3T3 using 67359-1-Ig (same clone as 67359-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67359-1-Ig (RALBP1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67359-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 67359-1-Ig (same clone as 67359-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67359-1-Ig (RALBP1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67359-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67359-1-Ig (same clone as 67359-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67359-1-Ig (RALBP1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67359-1-PBS in a different storage buffer formulation.

• 

  WB analysis of LNCaP using 67359-1-Ig (same clone as 67359-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 67359-1-Ig (RALBP1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67359-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 67359-1-Ig (same clone as 67359-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 67359-1-Ig (RALBP1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67359-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HEK-293 using 67359-1-Ig (same clone as 67359-1-PBS)

  1x10^6 HEK-293 cells were intracellularly stained with 0.25 ug RALBP1 Monoclonal antibody (67359-1-Ig, Clone:1B2F5) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.25 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 67359-1-PBS in a different storage buffer formulation.

RALBP1 Monoclonal Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 67359-1-PBS

Clone No.1B2F5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, FC (Intra), Indirect ELISA

Synonyms

1B2F5, 76 kDa Ral interacting protein, 76 kDa Ral-interacting protein, Dinitrophenyl S-glutathione ATPase, DNP SG ATPase

---

Product Information

67359-1-PBS targets RALBP1 in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28618

  Product name: Recombinant human RALBP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-351 aa of BC013126

  Sequence: MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDILHEPPDVVSDDEKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKKKEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQIDVPNLKPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRTTETEKVQEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQ

• Full Name: ralA binding protein 1
• Calculated Molecular Weight: 655 aa, 76 kDa
• Observed Molecular Weight: 95 kDa
• GenBank Accession Number: BC013126
• Gene Symbol: RALBP1
• Gene ID (NCBI): 10928
• RRID: AB_2882611
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15311
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.