RAMP1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• RAMP1 Recombinant monoclonal antibody, PBS Only (85271-2-PBS)

RAMP1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85271-2-PBS

Clone No.260848G8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Calcitonin-receptor-like receptor activity-modifying protein 1, CRLR activity-modifying protein 1, Receptor activity-modifying protein 1

• 

  WB analysis using 85271-2-RR (same clone as 85271-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85271-2-RR (RAMP1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85271-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

85271-2-PBS targets RAMP1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg9068

  Product name: Recombinant human RAMP1 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 27-118 aa of NM_005855.4

  Sequence: CQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSI

• Full Name: receptor (G protein-coupled) activity modifying protein 1
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: NM_005855.4
• Gene Symbol: RAMP1
• Gene ID (NCBI): 10267
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O60894
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RAMP1 (receptor-activity-modifying protein) is a member of the RAMP family of single-transmembrane-domain proteins which consist of an N-terminal extracellular domain, a transmembrane region, and a short intracellular C-terminal tail. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a G protein-coupled receptor, can function as either a calcitonin gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. RAMP1 transports the CRLR to the plasma membrane and then remains associated with it to function as a terminally glycosylated CGRP receptor, while RAMP2 and RAMP3 transfer the CRLR to the cell surface to generate receptors that are preferentially selective for adrenomedullin. RAMP1 can form a homodimer, which migrates at 30-37 kDa on SDS-PAGE. (PMID: 9620797; 16188935; 12051717;PMID: 18384073)