RANBP9 Polyclonal antibody

• 

  WB analysis of HeLa using 17755-1-AP

  WB result of RANBP9 antibody (17755-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-RANBP9 transfected HeLa cells.

• 

  WB analysis using 17755-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17755-1-AP (RANBP9 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 17755-1-AP

  IP result of anti-RANBP9 (IP:17755-1-AP, 4ug; Detection:17755-1-AP 1:600) with HeLa cells lysate 1600ug.

• 

  IHC staining of human testis using 17755-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 17755-1-AP (RANBP9 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 17755-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 17755-1-AP (RANBP9 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of mouse testis using 17755-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 17755-1-AP (RANBP9 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of mouse testis using 17755-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 17755-1-AP (RANBP9 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of rat testis using 17755-1-AP

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 17755-1-AP (RANBP9 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of rat testis using 17755-1-AP

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 17755-1-AP (RANBP9 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human skin using 17755-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 17755-1-AP (RANBP9 antibody) at dilution of 1:50 (under 10x lens).

• 

  IF Staining of HeLa using 17755-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using RANBP9 antibody (17755-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

• 

  IF Staining of HeLa using 17755-1-AP

  Immunofluorescent analysis of HeLa cells using 17755-1-AP (RANBP9 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

RANBP9 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 17755-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, canine

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

RanBP7, Ran-binding protein M, Ran-binding protein 9, BPM-L, BPM90

---

Tested Applications

• Positive WB detected in: mouse brain tissue, HeLa cells, mouse testis
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human testis tissue, human skin tissue, mouse testis tissue, rat testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

17755-1-AP targets RANBP9 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, canine samples.

• Tested Reactivity: human, mouse, rat, canine
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12112

  Product name: Recombinant human RANBP9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-389 aa of BC063849

  Sequence: MREWRTKIQAQIDRFPIGDREGEWQTMIQKMVSSYLVHHGYCATAEAFARSTDQTVLEELASIKNRQRIQKLVLAGRMGEAIETTQQLYPSLLERNPNLLFTLKVRQFIEMVNGTDSEVRCLGGRSPKSQDSYPVSPRPFSSPSMSPSHGMNIHNLASGKGSTAHFSGFESCSNGVISNKAHQSYCHSNKHQSSNLNVPELNSINMSRSQQVNNFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDCDTEMEVDSSQLRRQLCGGSQAAIERMIHFGRELQAMSEQLRRDCGKNTANKKMLKDAFSLLAYSDPWNSPVGNQLDPIQREPVCSALNSAILETHNLPKQPPLALAMGQATQCLGLMARSGIGSCAFATVEDYLH

• Full Name: RAN binding protein 9
• Calculated Molecular Weight: 388aa,43 kDa; 729aa,78 kDa
• Observed Molecular Weight: 80-90 kDa
• GenBank Accession Number: BC063849
• Gene Symbol: RANBP9
• Gene ID (NCBI): 10048
• RRID: AB_2176803
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96S59
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	mSphere; B Cell Receptor-Responsive miR-141 Enhances Epstein-Barr Virus Lytic Cycle via FOXO3 Inhibition.; Authors - Yan Chen
human	WB	Oncol Lett; RANBP9 suppresses tumor proliferation in colorectal cancer.; Authors - Chunzhi Qin
rat	IF	Acta Histochem; MicroRNA-26a-5p alleviates neuronal apoptosis and brain injury in intracerebral hemorrhage by targeting RAN binding protein 9.; Authors - Huiyuan Zhang
human	IHC	Transl Cancer Res; Reduced RANBP9 expression is associated with poor prognosis in colorectal cancer patients.; Authors - Guangbin Wu
mouse	WB	Nat Commun; Genome-wide screen of Mycobacterium tuberculosis-infected macrophages revealed GID/CTLH complex-mediated modulation of bacterial growth; Authors - Nelson V Simwela