RANBP9 Polyclonal antibody

• 

  WB analysis of mouse testis using 51038-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 51038-1-AP (RANBP9 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 51038-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 51038-1-AP (RANBP9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human cervical cancer using 51038-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 51038-1-AP (RANBP9 antibody) at dilution of 1:50 (under 10x lens).

RANBP9 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 51038-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, IHC, ELISA

Synonyms

BPM L, BPM90, RAN binding protein 9, Ran binding protein M, RanBP7, RANBP9, RANBPM

---

Tested Applications

• Positive WB detected in: mouse testis tissue
• Positive IHC detected in: human cervical cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below
• IP: See 1 publications below

Product Information

51038-1-AP targets RANBP9 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0428

  Product name: Recombinant human RANBP9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 571-788 aa of BC052781

  Sequence: ASGKGSTAHFSGFESCSNGVISNKAHQSYCHSNKHQSSNLNVPELNSINMSRSQQVNNFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDCDTEMEVDSSQLRRQLCGGSQAAIERMIHFGRELQAMSEQLRRDCGKNTANKKMLKDAFSLLAYSDPWNSPVGNQLDPIQREPVCSALNSAILETHNLPKQPPLALAMGQATQCLGLMARSG

• Full Name: RAN binding protein 9
• Calculated Molecular Weight: 729 aa, 78 kDa
• Observed Molecular Weight: 80-90 kDa
• GenBank Accession Number: BC052781
• Gene Symbol: RANBP9
• Gene ID (NCBI): 10048
• RRID: AB_670523
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96S59
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IP	Front Immunol; A T Cell Suppressive Circuitry Mediated by CD39 and Regulated by ShcC/Rai Is Induced in Astrocytes by Encephalitogenic T Cells.; Authors - Cristina Ulivieri
mouse	WB	J Cell Sci; Tex19 paralogs are new members of the piRNA pathway controlling retrotransposon suppression.; Authors - Yara Tarabay
human	IHC	J Neuropathol Exp Neurol; Gene expression profiling of NF-1-associated and sporadic pilocytic astrocytoma identifies aldehyde dehydrogenase 1 family member L1 (ALDH1L1) as an underexpressed candidate biomarker in aggressive subtypes.; Authors - Rodriguez Fausto J FJ