Tested Applications
| Positive WB detected in | mouse brain tissue, HeLa cells, mouse testis |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human testis tissue, human skin tissue, mouse testis tissue, rat testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17755-1-AP targets RANBP9 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, canine samples.
| Tested Reactivity | human, mouse, rat, canine |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12112 Product name: Recombinant human RANBP9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-389 aa of BC063849 Sequence: MREWRTKIQAQIDRFPIGDREGEWQTMIQKMVSSYLVHHGYCATAEAFARSTDQTVLEELASIKNRQRIQKLVLAGRMGEAIETTQQLYPSLLERNPNLLFTLKVRQFIEMVNGTDSEVRCLGGRSPKSQDSYPVSPRPFSSPSMSPSHGMNIHNLASGKGSTAHFSGFESCSNGVISNKAHQSYCHSNKHQSSNLNVPELNSINMSRSQQVNNFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDCDTEMEVDSSQLRRQLCGGSQAAIERMIHFGRELQAMSEQLRRDCGKNTANKKMLKDAFSLLAYSDPWNSPVGNQLDPIQREPVCSALNSAILETHNLPKQPPLALAMGQATQCLGLMARSGIGSCAFATVEDYLH Predict reactive species |
| Full Name | RAN binding protein 9 |
| Calculated Molecular Weight | 388aa,43 kDa; 729aa,78 kDa |
| Observed Molecular Weight | 80-90 kDa |
| GenBank Accession Number | BC063849 |
| Gene Symbol | RANBP9 |
| Gene ID (NCBI) | 10048 |
| RRID | AB_2176803 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96S59 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RANBP9 antibody 17755-1-AP | Download protocol |
| IHC protocol for RANBP9 antibody 17755-1-AP | Download protocol |
| IP protocol for RANBP9 antibody 17755-1-AP | Download protocol |
| WB protocol for RANBP9 antibody 17755-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-RANBP9 antibody (Cat# 17755-1-AP) has 6 citations across five journals: Nature Communications (×2), mSphere, Acta Histochem, Translational Cancer Research, and Oncology Letters. Research fields span tuberculosis/macrophage biology, Epstein-Barr virus lytic cycle regulation, neuronal apoptosis in intracerebral hemorrhage, colorectal cancer prognosis and tumor proliferation, and CTLH E3 ligase-mediated protein ubiquitination. Applications include WB, IF, and IHC in mouse, human, and rat species.
| Species | Application | Title |
|---|---|---|
Nat Commun Genome-wide screen of Mycobacterium tuberculosis-infected macrophages revealed GID/CTLH complex-mediated modulation of bacterial growth | ||
mSphere B Cell Receptor-Responsive miR-141 Enhances Epstein-Barr Virus Lytic Cycle via FOXO3 Inhibition. | ||
Acta Histochem MicroRNA-26a-5p alleviates neuronal apoptosis and brain injury in intracerebral hemorrhage by targeting RAN binding protein 9. | ||
Transl Cancer Res Reduced RANBP9 expression is associated with poor prognosis in colorectal cancer patients. | ||
Nat Commun Multimodal substrate recruitment enables CTLH(MKLN1) E3 ligase to target acetylated N-, C-, and internal degrons. |
Reviews
What customers say
The single review rates the antibody 4/5 for Western Blot on immortalized brown adipocytes. Using a 1:1000 primary dilution with 5% milk blocking and a 1:10000 anti-rabbit secondary, the user observed three bands, with the middle one strongest and matching the expected molecular weight. Overall, the antibody performed as expected for WB.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Lukas (Verified Customer) (08-07-2026) | WB with Blocking in 5% Milk for 1h, 1:1000 primary and 1:10000 secondary AB Anti-Rabbit, there are 3 Bands of which the middle one is the strongest. This one also fits to the expected kDa.
 |
