MOG1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MOG1 Polyclonal antibody (10552-1-AP)

MOG1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 10552-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Ran-binding protein MOG1, RanGNRF

• 

  WB analysis of SGC-7901 using 10552-1-AP

  SGC-7901 cells were subjected to SDS PAGE followed by western blot with 10552-1-AP (MOG1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 10552-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 10552-1-AP (MOG1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 10552-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10552-1-AP (MOG1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 10552-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 10552-1-AP (MOG1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10552-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10552-1-AP (MOG1 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10552-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10552-1-AP (MOG1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 10552-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using MOG1 antibody (10552-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4), CL488-Phalloidin (green).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MOG1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: SGC-7901 cells, HepG2 cells, mouse lung tissue, mouse testis tissue
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10552-1-AP targets MOG1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0824

  Product name: Recombinant human RANGRF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-165 aa of BC006486

  Sequence: MEPTRDCPLFGGAFSAILPMGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVRGEAAARYHFEDVGGVQGARAVHVESVQPLSLENLALRGRCQEAWVLSGKQQIAKENQQVRARECVMSWKGGSGDAEIQVSILTLIPLGSKGRDTSSGLAEAAPVPD

• Full Name: RAN guanine nucleotide release factor
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 18-22 kDa
• GenBank Accession Number: BC006486
• Gene Symbol: RANGRF
• Gene ID (NCBI): 29098
• RRID: AB_2238173
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HD47
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RANGRF, also named as MOG1, RANGNRF, HSPC165, HSPC236 and MDS5, regulates the intracellular trafficking of RAN. In cardiac cells it regulates the cell surface localization of SCN5A.

Publications

What published studies show

The MOG1 (RANGRF) polyclonal antibody (Cat# 10552-1-AP) has 3 total citations. These appear in Science Translational Medicine, Function, and Stem Cell Research. The associated research fields include cardiac gene therapy and arrhythmia modeling (Brugada syndrome), ER redox homeostasis and proinsulin trafficking in pancreatic β-cells, and CRISPR/Cas9-mediated generation of homozygous knockout human induced pluripotent stem cell lines.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Sci Transl Med; Gene therapy targeting protein trafficking regulator MOG1 in mouse models of Brugada syndrome, arrhythmias, and mild cardiomyopathy.; Authors - Gang Yu
	WB	Function (Oxf); ER Redox Homeostasis Regulates Proinsulin Trafficking and Insulin Granule Formation in the Pancreatic Islet β-Cell; Authors - Kristen E Rohli
		Stem Cell Res; Generation of a homozygous RANGRF knockout hiPSC line by CRISPR/Cas9 system; Authors - Meiling Jiang