RAP1B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RAP1B Polyclonal antibody (10840-1-AP)

• Featured Product
• KD/KO Validated

RAP1B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10840-1-AP Copied!

Publications (30)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

EC:3.6.5.2, GTP binding protein smg p21B, GTP-binding protein smg p21B, K REV, RAL1B

• 

  WB analysis using 10840-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10840-1-AP (RAP1B antibody) at dilution of 1:1000 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 10840-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 10840-1-AP (RAP1B antibody) at dilution of 1:300. .

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 10840-1-AP

  WB result of RAP1B antibody (10840-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-RAP1B transfected A431 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10840-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10840-1-AP (RAP1B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 10840-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 10840-1-AP (RAP1B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 10840-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 10840-1-AP (RAP1B antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 10840-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10840-1-AP (RAP1B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of C6 using 10840-1-AP

  C6 cells were subjected to SDS PAGE followed by western blot with 10840-1-AP (RAP1B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human oesophagus cancer using 10840-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 10840-1-AP (RAP1B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human oesophagus cancer using 10840-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 10840-1-AP (RAP1B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RAP1B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, A431 cells, A549 cells, C6 cells, human brain tissue, mouse brain tissue, NIH/3T3 cells, HepG2 cells, mouse kidney tissue
• Positive IHC detected in: human oesophagus cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10840-1-AP targets RAP1B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, chicken, goat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1282

  Product name: Recombinant human RAP1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-184 aa of BC000176

  Sequence: MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL

• Full Name: RAP1B, member of RAS oncogene family
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC000176
• Gene Symbol: RAP1B
• Gene ID (NCBI): 5908
• RRID: AB_2253539
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61224
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAP1B is a member of the RAS-like small GTP-binding protein superfamily. Members of this family regulate multiple cellular processes including cell adhesion and growth and differentiation. RAP1B localizes to cellular membranes and has been shown to regulate integrin-mediated cell signaling. It also plays a role in regulating outside-in signaling in platelets.

Publications

What published studies show

The anti-RAP1B antibody (Cat# 10840-1-AP) has accumulated 30 citations published in journals such as Molecular Cell, Journal of Clinical Investigation, Journal of Advanced Research, Oncotarget, Cell Signaling, iScience, Carcinogenesis, and Viruses. Associated research fields include oncology (liver, colorectal, ovarian, lung, and pancreatic cancers), hematology and thrombosis, virology, diabetes, pulmonary fibrosis, preeclampsia, neurodevelopment, ophthalmology, and reproductive biology.

Automatically generated from the 30 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Adv Res; 33-kDa ANXA3 isoform contributes to hepatocarcinogenesis via modulating ERK, PI3K/Akt-HIF and intrinsic apoptosis pathways.; Authors - Chunmei Guo
human	WB	Mol Cell; Macrophage-Associated PGK1 Phosphorylation Promotes Aerobic Glycolysis and Tumorigenesis.; Authors - Yajuan Zhang
human	WB	J Clin Invest; Somatic RAP1B gain-of-function variant underlies isolated thrombocytopenia and immunodeficiency; Authors - Marta Benavides-Nieto
human	WB	Oncotarget; LncRNA MT1JP functions as a tumor suppressor by interacting with TIAR to modulate the p53 pathway.; Authors - Lihui Liu
human	WB	Int J Mol Sci; Molecular and Pharmacological Characterization of the Interaction between Human Geranylgeranyltransferase Type I and Ras-Related Protein Rap1B.; Authors - Sonja Hinz
		Front Pharmacol; The effect and mechanism of total alkaloids of Fritillariae Pallidiflorae Bulbus in alleviating pulmonary fibrosis.; Authors - Mingxin Pai