RAP1B Monoclonal antibody, PBS Only

• 

  WB analysis using 67174-1-Ig (same clone as 67174-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67174-1-Ig (RAP1B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67174-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 67174-1-Ig (same clone as 67174-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67174-1-Ig (RAP1B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67174-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 67174-1-Ig (same clone as 67174-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67174-1-Ig (RAP1B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67174-1-PBS in a different storage buffer formulation.

• 

  WB analysis of 4T1 using 67174-1-Ig (same clone as 67174-1-PBS)

  4T1 cells were subjected to SDS PAGE followed by western blot with 67174-1-Ig (RAP1B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67174-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human oesophagus cancer using 67174-1-Ig (same clone as 67174-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 67174-1-Ig (RAP1B antibody) at dilution of 1:1 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67174-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human oesophagus cancer using 67174-1-Ig (same clone as 67174-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 67174-1-Ig (RAP1B antibody) at dilution of 1:1 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67174-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67174-1-Ig (same clone as 67174-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using RAP1B antibody (67174-1-Ig, Clone: 2E7G11 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67174-1-PBS in a different storage buffer formulation.

RAP1B Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67174-1-PBS

Clone No.2E7G11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

2E7G11, EC:3.6.5.2, GTP binding protein smg p21B, GTP-binding protein smg p21B, K REV

---

Product Information

67174-1-PBS targets RAP1B in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29212

  Product name: Recombinant human RAP1B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-184 aa of BC000176

  Sequence: MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL

• Full Name: RAP1B, member of RAS oncogene family
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC000176
• Gene Symbol: RAP1B
• Gene ID (NCBI): 5908
• RRID: AB_2882470
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P61224
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.