RAP1GAP2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RAP1GAP2 Polyclonal antibody, PBS Only (25391-1-PBS)

• 

  WB analysis using 25391-1-AP (same clone as 25391-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25391-1-AP (GARNL4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25391-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 25391-1-AP (same clone as 25391-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 25391-1-AP (RAP1GAP2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25391-1-PBS in a different storage buffer formulation.

RAP1GAP2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25391-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

GARNL4, RAP1GA3, RAP1GA2, Rap1 GTPase-activating protein 2, KIAA1039

---

Product Information

25391-1-PBS targets RAP1GAP2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21840

  Product name: Recombinant human GARNL4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 500-730 aa of BC140870

  Sequence: AIRVRSHSMETMVGGQKKSHSGGIPGSLSGGISHNSMEVTKTTFSPPVVAATVKNQSRSPIKRRSGLFPRLHTGSEGQGDSRARCDSTSSTPKTPDGGHSSQEIKSETSSNPSSPEICPNKEKPFMKLKENGRAISRSSSSTSSVSSTAGEGEAMEEGDSGGSQPSTTSPFKQEVFVYSPSPSSESPSLGAAATPIIMSRSPTDAKSRNSPRSNLKFRFDKLSHASSGAGH

• Full Name: GTPase activating Rap/RanGAP domain-like 4
• Calculated Molecular Weight: 730 aa, 80 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC140870
• Gene Symbol: RAP1GAP2
• Gene ID (NCBI): 23108
• RRID: AB_2880057
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q684P5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.