RAP2A Polyclonal antibody

• 

  WB analysis of A431 using 13789-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 13789-1-AP (RAP2A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 13789-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 13789-1-AP (RAP2A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 13789-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13789-1-AP (RAP2A antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 13789-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 13789-1-AP (RAP2A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 13789-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 13789-1-AP (RAP2A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 13789-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 13789-1-AP (RAP2A antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 13789-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13789-1-AP (RAP2A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of MCF-7 using 13789-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed MCF-7 cells using 13789-1-AP (RAP2A antibody) at dilution of 1:50 and CoraLite488-Conjugated Goat Anti-Rabbit IgG(H+L).

RAP2A Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 13789-1-AP

Publications(2)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

RbBP 30, RbBP-30, Ras-related protein Rap-2a, Ras related protein Rap 2a, RAP2

---

Tested Applications

• Positive WB detected in: A431 cells, mouse lung tissue, K-562 cells, mouse brain tissue, PC-3 cells, HeLa cells
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:3000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below

Product Information

13789-1-AP targets RAP2A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4808

  Product name: Recombinant human RAP2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-183 aa of BC041333

  Sequence: MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ

• Full Name: RAP2A, member of RAS oncogene family
• Calculated Molecular Weight: 183 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC041333
• Gene Symbol: RAP2A
• Gene ID (NCBI): 5911
• RRID: AB_2177303
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P10114
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Rep; miR-9 and miR-124 synergistically affect regulation of dendritic branching via the AKT/GSK3β pathway by targeting Rap2a.; Authors - Qian Xue
human	IHC, WB	Clin Exp Med; RAP2A promotes apoptosis resistance of hepatocellular carcinoma cells via the mTOR pathway.; Authors - Jing-Ru Yang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Joleen (Verified Customer) (05-29-2019)

RAP2A should be 21kD, no prominent bands appeared at that molecular weight.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1k
• Cell Tissue Type: MDCK GII

RAP2A Antibody Western Blot, validation (1:1k dilution) in MDCK GII (Cat no:13789-1-AP)