RAP2B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RAP2B Polyclonal antibody (16266-1-AP)

RAP2B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16266-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Ras-related protein Rap-2b, Ras related protein Rap 2b, EC:3.6.5.2

• 

  WB analysis using 16266-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16266-1-AP (RAP2B antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat brain using 16266-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 16266-1-AP (RAP2B Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 16266-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 16266-1-AP (RAP2B antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 16266-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 16266-1-AP (RAP2B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 16266-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 16266-1-AP (RAP2B antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RAP2B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, MCF-7 cells, rat brain tissue, HEK-293 cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16266-1-AP targets RAP2B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9331

  Product name: Recombinant human RAP2B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-183 aa of BC012362

  Sequence: MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL

• Full Name: RAP2B, member of RAS oncogene family
• Calculated Molecular Weight: 183 aa, 21 kDa
• Observed Molecular Weight: 19-22 kDa
• GenBank Accession Number: BC012362
• Gene Symbol: RAP2B
• Gene ID (NCBI): 5912
• RRID: AB_2177311
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61225
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAP2B belongs to a family of RAS-related genes. It share approximately 50% amino acid identity with the classical RAS proteins and have numerous structural features in common. Rap2B is a platelet protein that is activated by thrombin and involved in platelet activation. RAP2B may be a novel candidate oncogene that plays important roles in carcinogenesis through activation of NF-kappaB pathway.

Publications

What published studies show

The RAP2B Polyclonal antibody (Cat# 16266-1-AP) has 1 total citation. It appears in the Journal of Biological Chemistry (J Biol Chem), published in 2012. The cited study investigated protein palmitoylation and neuronal differentiation in cultured cells, using the antibody for Western blot analysis in mouse samples. The research field encompasses lipid modification biology and neurobiology.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Biol Chem; DHHC5 protein palmitoylates flotillin-2 and is rapidly degraded on induction of neuronal differentiation in cultured cells.; Authors - Li Yi Y