RAPGEF1 Polyclonal antibody

• 

RAPGEF1 Polyclonal Antibody for ELISA

Cat No. 14369-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

C3G, CRK SH3 binding GNRP, GRF2, Protein C3G, RAPGEF1

---

Product Information

14369-1-AP targets RAPGEF1 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5698

  Product name: Recombinant human RAPGEF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 748-1095 aa of BC041710

  Sequence: EELIKKLQYRYEKFSPFADTFKKRVSKNTFFVLVRVVDELCLVELTEEILKLLMELVFRLVCNGELSLARVLRKNILDKVDQKKLLRCATSSQPLAARGVAARPGTLHDFHSHEIAEQLTLLDAELFYKIEIPEVLLWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIKIMKHLRKLNNFNSYLAILSALDSAPIRRLEWQKQTSEGLAEYCTLIDSSSSFRAYRAALSEVEPPCIPYLGLILQDLTFVHLGNPDYIDGKVNFSKRWQQFNILDSMRCFQQAHYDMRRNDDIINFFNDFSDHLAEEALWELSLKIKPRNITRRKTDREEKT

• Full Name: Rap guanine nucleotide exchange factor (GEF) 1
• Calculated Molecular Weight: 121 kDa
• GenBank Accession Number: BC041710
• Gene Symbol: RAPGEF1
• Gene ID (NCBI): 2889
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13905
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.