RAPGEF5 Polyclonal antibody

• 

  WB analysis of human brain using 12556-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12556-1-AP (RAPGEF5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 12556-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12556-1-AP (RAPGEF5 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 12556-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12556-1-AP (RAPGEF5 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 12556-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12556-1-AP (RAPGEF5 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 12556-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 12556-1-AP (RAPGEF5 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 12556-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12556-1-AP (RAPGEF5 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

RAPGEF5 Polyclonal Antibody for WB, ELISA

Cat No. 12556-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, RIP, ELISA

Synonyms

GFR, KIAA0277, M Ras regulated Rap GEF, MR GEF, MRGEF, RAPGEF5, Related to Epac, REPAC

---

Tested Applications

• Positive WB detected in: human brain tissue, HEK-293 cells, HeLa cells, K-562 cells, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• RIP: See 1 publications below

Product Information

12556-1-AP targets RAPGEF5 in WB, RIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3229

  Product name: Recombinant human RAPGEF5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 129-444 aa of BC039203

  Sequence: KKYQGKEENSDVPRRKRKVLHLVSQWIALYKDWLPEDEHSKMFLKTIYRNVLDDVYEYPILEKELKEFQKILGMHRRHTVDEYSPQKKNKALFHQFSLKENWLQHRGTVTETEEIFCHVYITEHSYVSVKAKVSSIAQEILLCSQLGKRVQLVKKFIKIAAHCKAQRNLNSFFAIVMGLNTASVSRLSQTWEKIPGKFKKLFSELESLTDPSLNHKAYRDAFKKMKPPKIPFVPLLLKDVTFIHEGNKTFLDNLVNFEKLHMIADTVRTLRHCRTNQFGDLSPKEHQELKSYVNHLYVIDSQQALFELSHRIEPRV

• Full Name: Rap guanine nucleotide exchange factor (GEF) 5
• Calculated Molecular Weight: 68 kDa
• Observed Molecular Weight: 68-75 kDa
• GenBank Accession Number: BC039203
• Gene Symbol: RAPGEF5
• Gene ID (NCBI): 9771
• RRID: AB_2177476
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92565
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,RIP	Redox Biol; CircRAPGEF5 interacts with RBFOX2 to confer ferroptosis resistance by modulating alternative splicing of TFRC in endometrial cancer; Authors - Jun Zhang