RAPSN Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RAPSN Polyclonal antibody (20453-1-AP)

RAPSN Polyclonal Antibody for WB, ELISA

Cat No. 20453-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

43 kDa postsynaptic protein, CMS1D, CMS1E, RAPSN, RAPsyn, RING finger protein 205, RNF205

• 

  WB analysis of U-937 using 20453-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 20453-1-AP (RAPSN Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 20453-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 20453-1-AP (RAPSN Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 20453-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 20453-1-AP (RAPSN Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of U-937 using 20453-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 20453-1-AP (RAPSN Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Y79 using 20453-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 20453-1-AP (RAPSN Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 20453-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 20453-1-AP (RAPSN Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 20453-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 20453-1-AP (RAPSN Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of U-937 using 20453-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 20453-1-AP (RAPSN Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of U-937 using 20453-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 20453-1-AP (RAPSN Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Y79 using 20453-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 20453-1-AP (RAPSN Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Y79 using 20453-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 20453-1-AP (RAPSN Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RAPSN in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: U-937 cells, NIH/3T3 cells, Y79 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20453-1-AP targets RAPSN in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13896

  Product name: Recombinant human RAPSN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-353 aa of BC004196

  Sequence: MGQDQTKKQIEKGLQLYQSNQTEKALQVWTKVLEKSSDLMGRFRVLGCLVTAHSEMGRYKEMLKFAVVQIDTARELEDADFLLESYLNLARSNEKLCEFHKTISYCKTCLGLPGTRAGAQLGGQVSLSMGNAFLGLSVFQKALESFEKALRYAHNNDDAMLECRVCCSLGSFYAQVKDYEKALFFPCKAAELVNNYGKGWSLKYRAMSQYHMAVAYRLLGRLGSAMECCEESMKIALQHGDRPLQALCLLCFADIHRSRGDLELSQLKLHCLSESIYRSKGLQRELRAHVVRFHECVEETELYCGLCGESIGEKNSRLQALPCSHIFHLRCLQNNGTRSCPNCRRSSMKPGFV

• Full Name: receptor-associated protein of the synapse
• Calculated Molecular Weight: 412 aa, 46 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC004196
• Gene Symbol: RAPSN
• Gene ID (NCBI): 5913
• RRID: AB_2878689
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13702
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The RAPSN polyclonal antibody (Cat# 20453-1-AP) has 1 citation. It was used in a study published in Journal of Applied Physiology (2023), which investigated plasticity changes in neuromuscular junction morphology and related regulatory proteins in hibernating ground squirrels. The research field is neuroscience, specifically neuromuscular junction biology. The antibody was applied by Western blot (WB).

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	J Appl Physiol (1985); Plasticity changes in neuromuscular junction morphology and related regulatory proteins in the hibernating ground squirrel; Authors - Yue He