RARA Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• RARA Recombinant monoclonal antibody, PBS Only (88230-1-PBS)

RARA Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 88230-1-PBS

Clone No.260537D9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

NR1B1, RAR, RAR alpha, RAR-alpha, Retinoic acid receptor alpha

• 

  WB analysis using 88230-1-RR (same clone as 88230-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88230-1-RR (RARA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88230-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 88230-1-RR (same clone as 88230-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using RARA antibody (88230-1-RR, Clone: 260537D9 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 88230-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88230-1-PBS targets RARA in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0420

  Product name: Recombinant human RARA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 80-421 aa of BC008727

  Sequence: PLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLD

• Full Name: retinoic acid receptor, alpha
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 50-60 kDa
• GenBank Accession Number: BC008727
• Gene Symbol: RARA
• Gene ID (NCBI): 5914
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10276
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Retinoic acid receptors (RARs) function as nuclear receptors that control gene expression in response to binding of the ligand retinoic acid (RA). Retinoic acid receptor alpha (RARα), also known as NR1B1 (nuclear receptor subfamily 1, group B, member 1), plays an essential role in the regulation of retinoic acid-induced germ cell development during spermatogenesis. Formation of a complex with histone deacetylases might lead to inhibition of RARE DNA element binding and to transcriptional repression (PubMed:28167758). Transcriptional activation and RARE DNA element binding might be supported by the transcription factor KLF2 (PubMed:28167758).