Tested Applications
| Positive WB detected in | Sp2/0 cells |
| Positive IHC detected in | mouse colon tissue, mouse bladder tissue, human pancreas cancer tissue, human renal cell carcinoma tissue, mouse brain tissue, rat bladder tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14013-1-AP targets RARB in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5119 Product name: Recombinant human RARB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 99-448 aa of BC060794 Sequence: EGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ Predict reactive species |
| Full Name | retinoic acid receptor, beta |
| Calculated Molecular Weight | 50 kDa |
| Observed Molecular Weight | 37-51 kDa |
| GenBank Accession Number | BC060794 |
| Gene Symbol | RARB |
| Gene ID (NCBI) | 5915 |
| RRID | AB_2177765 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P10826 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Retinoic acid receptors (RARs) are important mediators of retinoid signaling in morphogenesis, development, and cell differentiation. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes (PMID:12554770). They can bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In the absence or presence of hormone ligand, they act mainly as activators of gene expression due to weak binding to corepressors. RARB is one isotypes of RARs (PMID:12834868).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RARB antibody 14013-1-AP | Download protocol |
| IHC protocol for RARB antibody 14013-1-AP | Download protocol |
| WB protocol for RARB antibody 14013-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RARB Polyclonal antibody (Cat# 14013-1-AP) has 10 citations published in journals including Nature, Nat Cancer, Nat Metab, Adv Sci, J Transl Med, Front Pharmacol, J Mol Cell Cardiol, iScience, Antiviral Res, and bioRxiv. Research fields span pancreatic cancer, traumatic brain injury, endometrial cancer, myocardial hypertrophy, viral replication, retinoic acid signaling, prefrontal-motor arealization, and ovarian metabolic syndrome. Applications cited include WB, IHC, and IF across human, mouse, rat, and monkey species.
| Species | Application | Title |
|---|---|---|
Nat Cancer Low-protein diet enhances antitumor immunity in pancreatic cancer through microbiota-derived UDP-galactose | ||
Adv Sci (Weinh) Clinically Inspired Multimodal Treatment Using Induced Neural Stem Cells-Derived Exosomes Promotes Recovery of Traumatic Brain Injury through Microglial Modulation | ||
J Transl Med Notch3 enhances the synergistic effect of all-trans retinoic acid and calcipotriol in pancreatic stellate cell activation | ||
Front Pharmacol Canagliflozin alleviates progestin resistance by suppressing RARβ/CRABP2 signaling in THRB knockout endometrial cancer cells | ||
J Mol Cell Cardiol Impaired retinoic acid signaling mediated Rbm20 downregulation induces aberrant splicing of Ca(V)1.2 calcium channel: implications in myocardial hypertrophy. | ||
