RARB Monoclonal antibody

• 

  WB analysis of MCF-7 using 60119-1-Ig

  MCF7 cells were subjected to SDS PAGE followed by western blot with 60119-1-Ig (RARB antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

RARB Monoclonal Antibody for WB, ELISA

Cat No. 60119-1-Ig

Clone No.3G9F11

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, ELISA

Synonyms

---

Tested Applications

• Positive WB detected in: MCF7 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60119-1-Ig targets RARB in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6013

  Product name: Recombinant human RARB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 99-448 aa of BC060794

  Sequence: EGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ

• Full Name: retinoic acid receptor, beta
• Calculated Molecular Weight: 50 kDa
• GenBank Accession Number: BC060794
• Gene Symbol: RARB
• Gene ID (NCBI): 5915
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P10826
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Retinoic acid receptors (RARs) are important mediators of retinoid signaling in morphogenesis, development, and cell differentiation. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes [PMID:12554770]. They can bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In the absence or presence of hormone ligand, they act mainly as activators of gene expression due to weak binding to corepressors. In concert with RARG, RARs are required for skeletal growth, matrix homeostasis and growth plate function. RARB is one isotypes of RARs [PMID:12834868]