Tested Applications
| Positive WB detected in | human plasma tissue |
| Positive IHC detected in | human placenta tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Chemerin has low expression in most cells and tissues
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10216-1-AP targets Chemerin/RARRES2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0261 Product name: Recombinant human RARRES2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-163 aa of BC000069 Sequence: MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS Predict reactive species |
| Full Name | retinoic acid receptor responder (tazarotene induced) 2 |
| Calculated Molecular Weight | 163 aa, 19 kDa |
| Observed Molecular Weight | 14-19 kDa |
| GenBank Accession Number | BC000069 |
| Gene Symbol | RARRES2 |
| Gene ID (NCBI) | 5919 |
| RRID | AB_2269231 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99969 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Chemerin, also named as TIG2 and RARRES2, is adipocyte-secreted protein (adipokine) that regulates adipogenesis, metabolism and inflammation through activation of the chemokine-like receptor 1 (CMKLR1). Its other ligands include G protein-coupled receptor 1 (GPR1) and chemokine receptor-like 2 (CCRL2). It positively regulates adipocyte differentiation, modulates the expression of adipocyte genes involved in lipid and glucose metabolism and might play a role in angiogenesis, a process essential for the expansion of white adipose tissue. RARRES2 have both pro- and anti-inflammatory properties depending on the modality of enzymatic cleavage by different classes of proteases. The MW of Chemerin is 14-19 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Chemerin/RARRES2 antibody 10216-1-AP | Download protocol |
| WB protocol for Chemerin/RARRES2 antibody 10216-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Chemerin/RARRES2 Polyclonal antibody (Cat# 10216-1-AP) has 14 citations published in journals including Nature Communications, Cell Stem Cell, Molecular Medicine, iScience, Frontiers in Pharmacology, Frontiers in Oncology, Cancer Cell International, Biomedicines, and PLoS One. Research fields span oncology (breast cancer, glioblastoma, oral squamous cell carcinoma), fibrosis (dermal, keloid, dental pulp), cardiovascular disease (pulmonary arterial hypertension, diaphragm dysfunction), metabolic disorders (insulin resistance, lipid metabolism), and endocrinology (osteoporosis, endometriosis).
| Species | Application | Title |
|---|---|---|
Mil Med Res RARRES2 regulates lipid metabolic reprogramming to mediate the development of brain metastasis in triple negative breast cancer | ||
Cell Stem Cell Multi-omic analysis reveals retinoic acid molecular drivers for dermal fibrosis and regenerative repair in the skin. | ||
Nat Commun Intercellular chemerin-cmklr1 couples epicardial mechanosensing to fibroblasts in pressure overload. | ||
Mol Med Assessing personalized molecular portraits underlying endothelial-to-mesenchymal transition within pulmonary arterial hypertension | ||
Cancer Cell Int Targeting copper death genotyping associated gene RARRES2 suppresses glioblastoma progression and macrophages infiltration | ||
J Biol Eng Clitocine suppresses TNBC progression by boosting CCRL2 to block survival signals and neutrophil-driven inflammation.
|
Reviews
What customers say
The antibody performed well in Western Blot and Immunofluorescence on 786-O cells at a 1:300 dilution. It detected the correct protein band with good specificity. The reviewer rated it 4 out of 5, noting that further optimization for IHC would be beneficial. Overall, it is a reliable, specific reagent for its tested applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Owen (Verified Customer) (10-07-2019) | The antibody manages to detect the correct band of the protein and is specific. Further optimization for IHC would be great.
|
