RARS Polyclonal antibody

• 

  WB analysis of HeLa using 27344-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 27344-1-AP (RARS antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 27344-1-AP

  WB result of RARS antibody (27344-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RARS transfected HeLa cells.

• 

  WB analysis of A431 using 27344-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 27344-1-AP (RARS antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U-251 using 27344-1-AP

  U-251 cells were subjected to SDS PAGE followed by western blot with 27344-1-AP (RARS antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 27344-1-AP

  IP result of anti-RARS (IP:27344-1-AP, 4ug; Detection:27344-1-AP 1:500) with HeLa cells lysate 3200 ug.

• 

  IHC staining of human heart using 27344-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 27344-1-AP (RARS antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human heart using 27344-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 27344-1-AP (RARS antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human breast cancer using 27344-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27344-1-AP (RARS antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 27344-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27344-1-AP (RARS antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

RARS Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 27344-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IP, ELISA

Synonyms

Arginine tRNA ligase, arginyl tRNA synthetase, ArgRS, DALRD1, RARS

---

Tested Applications

• Positive WB detected in: HeLa cells, A431 cells, U-251 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human heart tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 5 publications below

Product Information

27344-1-AP targets RARS in WB, IHC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26390

  Product name: Recombinant human RARS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-190 aa of BC000528

  Sequence: MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLKLKYRLNILRKSLQAERNKPTKNMINIISRLQEVFGHAIKAAYPDLENPPLLVTPSQQAKFGDYQCNSAMGISQMLKTKEQKVNPREIAENITKHLPDNECIEKVEIAGPGFINVHLRKDFVSEQLTSLLVNGVQLPALGE

• Full Name: arginyl-tRNA synthetase
• Calculated Molecular Weight: 75 kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: BC000528
• Gene Symbol: RARS
• Gene ID (NCBI): 5917
• RRID: AB_2880849
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P54136
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RARS, also named ArgRS (arginyl-tRNA synthetase), belongs to the class-I aminoacyl-tRNA synthetase family which catalyze the aminoacylation of tRNA by their cognate amino acid. In higher eukaryotes, one of the two arginyl-tRNA synthetases (ArgRSs) has evolved to have an extended N-terminal domain that plays a crucial role in protein synthesis and cell growth and in integration into the multisynthetase complex (MSC) (PMID:25288775). RARS has two isoforms with the molecular weight of 75 and 67 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; Arginine deprivation enriches lung cancer proteomes with cysteine by inducing arginine-to-cysteine substitutants; Authors - Chao Yang ; KD Validated
human	WB	Mol Cell; A methyltransferase-independent role for METTL1 in tRNA aminoacylation and oncogenic transformation; Authors - Raja H Ali
human	WB	bioRxiv; Arginine limitation causes a directed DNA sequence evolution response in colorectal cancer cells; Authors - Dennis J Hsu ; KD Validated
human	WB	Sci Adv; Arginine limitation drives a directed codon-dependent DNA sequence evolution response in colorectal cancer cells; Authors - Dennis J Hsu ; KD Validated
rat	WB	Mol Neurobiol; Verification of Pain-Related Neuromodulation Mechanisms of Calcitonin in Knee Osteoarthritis; Authors - Qing Lin