RASA2/3 Polyclonal antibody

• 

  WB analysis of 3T3-L1 using 27835-1-AP

  3T3-L1 cells were subjected to SDS PAGE followed by western blot with 27835-1-AP (RASA2/3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 27835-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 27835-1-AP (RASA2/3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

RASA2/3 Polyclonal Antibody for WB, ELISA

Cat No. 27835-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse and More (1)

Applications

WB, ELISA

Synonyms

GAP1(IP4BP), GAP1IP4BP, GAPIII, Ins P4 binding protein, RAS p21 protein activator 3, RASA2/3, RASA3

---

Tested Applications

• Positive WB detected in: 3T3-L1 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

27835-1-AP targets RASA2/3 in WB, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27152

  Product name: Recombinant human RASA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 563-834 aa of BC038456

  Sequence: SSGRRDPKSVEQPIVLKEGFMIKRAQGRKRFGMKNFKKRWFRLTNHEFTYHKSKGDQPLYSIPIENILAVEKLEEESFKMKNMFQVIQPERALYIQANNCVEAKDWIDILTKVSQCNQKRLTVYHPSAYLSGHWLCCRAPSDSAPGCSPCTGGLPANIQLDIDGDRETERIYSLFNLYMSKLEKMQEACGSKSVYDGPEQEEYSTFVIDDPQETYKTLKQVIAGVGALEQEHAQYKRDKFKKTKYGSQEHPIGDKSFQNYIRQQSETSTHSI

• Full Name: RAS p21 protein activator 3
• Calculated Molecular Weight: 834 aa, 96 kDa
• Observed Molecular Weight: 96 kDa
• GenBank Accession Number: BC038456
• Gene Symbol: RASA3
• Gene ID (NCBI): 22821
• RRID: AB_2880988
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14644
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Rasa3 is a GTPase activating protein of the GAP1 family which targets R-Ras and Rap1. While R-Ras has been extensively studied due to its involvement in cancer, Rap1 has recently attracted a lot of attention due to its central role in development and morphogenesis of higher organisms, especially in the cardiovasculature. This antibody can react with RASA2 and RASA3.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Arterioscler Thromb Vasc Biol; Lipid Receptor GPR31 (G-Protein-Coupled Receptor 31) Regulates Platelet Reactivity and Thrombosis Without Affecting Hemostasis.; Authors - Layla Van Doren
mouse	WB	Front Immunol; The Rac-GEF Tiam1 controls integrin-dependent neutrophil responses; Authors - Kirsti Hornigold