RASA2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RASA2 Polyclonal antibody (31586-1-AP)

• 

  IP experiment of Jurkat using 31586-1-AP

  IP result of anti-RASA2 (IP:31586-1-AP, 4ug; Detection:31586-1-AP 1:1000) with Jurkat cells lysate 1920 ug.

• 

  IP experiment of A431 using 31586-1-AP

  IP result of anti-RASA2 (IP:31586-1-AP, 4ug; Detection:31586-1-AP 1:1000) with A431 cells lysate 1120 ug.

• 

  IHC staining of human Hepatocellular carcinoma using 31586-1-AP

  Immunohistochemical analysis of paraffin-embedded human Hepatocellular carcinoma slide using 31586-1-AP (RASA2 antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 31586-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using RASA2 antibody (31586-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

RASA2 Polyclonal Antibody for IHC, IF/ICC, IP, ELISA

Cat No. 31586-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, IP, ELISA

Synonyms

GAP1M, RAS p21 protein activator 2, RASGAP

---

Tested Applications

• Positive IP detected in: Jurkat cells, A431 cells
• Positive IHC detected in: human Hepatocellular carcinoma; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:300-1:1200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31586-1-AP targets RASA2 in IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35885

  Product name: Recombinant human RASA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 700-850 aa of NM_001303245

  Sequence: VLCRVSRCNQNRLSFYHPSVYLNGNWLCCQETGENTLGCKPCTAGVPADIQIDIDEDRETERIYSLFTLSLLKLQKMEEACGTIAVYQGPQKEPDDYSNFVIEDSVTTFKTIQQIKSIIEKLDEPHEKYRKKRSSSAKYGSKENPIVGKAS

• Full Name: RAS p21 protein activator 2
• Calculated Molecular Weight: 96kDa
• Observed Molecular Weight: 97 kDa
• GenBank Accession Number: NM_001303245
• Gene Symbol: RASA2
• Gene ID (NCBI): 5922
• RRID: AB_3742452
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q15283
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ras GTPase-activating protein 2 (RASA2) is also named GAP1M and RASGAP. RASA2 was a critical RAS-specific GAP, inhibition of which permitted increased proliferation following TCR stimulation under conditions of immunosuppression (PMID: 37858490). RASA2 was identified as an inhibitor of RAS signaling in multiple human tumors, including melanoma, where inactivating RASA2 mutations have been found (PMID: 26502337). RASA2 is also one of the genes mutated in Noonan syndrome, a Rasopathy associated with developmental defects and elevated RAS activity (PMID: 25049390). RASA2 is expressed in both CD4+ and CD8+ T cells (PMID: 36002574).