Dexras1 Polyclonal antibody

Dexras1 Polyclonal Antibody for ELISA
Cat No. 25010-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

RASD1, RAS, dexamethasone induced 1, Dexamethasone-induced Ras-related protein 1, AGS1, Activator of G-protein signaling 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Published Applications

WBSee 1 publications below

Product Information

25010-1-AP targets Dexras1 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityrat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18818

Product name: Recombinant human RASD1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 145-250 aa of BC018041

Sequence: NKGDRDFYREVDQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKALRNKKLLRAGSGGGGGDPGDAFGIVAPFA

Predict reactive species
Full Name RAS, dexamethasone-induced 1
Calculated Molecular Weight 281 aa, 32 kDa
GenBank Accession NumberBC018041
Gene Symbol Dexras1
Gene ID (NCBI) 51655
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y272
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Publications

SpeciesApplicationTitle
ratWB

Toxicol In Vitro

MiR-301b-3p/3584-5p enhances low-dose mono-n-butyl phthalate (MBP)-induced proliferation by targeting Rasd1 in Sertoli cells.

Authors - Xiaoqin Yin
Loading...
||
New chat Able
正在加载,请稍候...