Filter: AllWBIHC

WB analysis using 26788-1-AP (same clone as 26788-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 26788-1-AP (RASGRF2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26788-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 26788-1-AP (same clone as 26788-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 26788-1-AP (RASGRF2 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26788-1-PBS in a different storage buffer formulation.

RASGRF2 Polyclonal antibody, PBS Only

Name: RASGRF2 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 26788-1-PBS

RASGRF2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 26788-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

26788-1-PBS targets RASGRF2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag25354 Product name: Recombinant human RASGRF2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 748-876 aa of BC136296 Sequence: TSPLNSKIGALDLTTSSSPTTTTQSPAASPPPHTGQIPLDLSRGLSSPEQSPGTVEENVDNPRVDLCNKLKRSIQKAVLESAPADRAGVESSPAADTTELSPCRSPSTPRHLRYRQPGGQTADNAHCSV Predict reactive species
Full Name	Ras protein-specific guanine nucleotide-releasing factor 2
Observed Molecular Weight	141 kDa
GenBank Accession Number	BC136296
Gene Symbol	RASGRF2
Gene ID (NCBI)	5924
RRID	AB_2918110
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O14827
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™