Product Information
26788-1-PBS targets RASGRF2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25354 Product name: Recombinant human RASGRF2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 748-876 aa of BC136296 Sequence: TSPLNSKIGALDLTTSSSPTTTTQSPAASPPPHTGQIPLDLSRGLSSPEQSPGTVEENVDNPRVDLCNKLKRSIQKAVLESAPADRAGVESSPAADTTELSPCRSPSTPRHLRYRQPGGQTADNAHCSV Predict reactive species |
| Full Name | Ras protein-specific guanine nucleotide-releasing factor 2 |
| Observed Molecular Weight | 141 kDa |
| GenBank Accession Number | BC136296 |
| Gene Symbol | RASGRF2 |
| Gene ID (NCBI) | 5924 |
| RRID | AB_2918110 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14827 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



