RASGRP4 Polyclonal antibody

• 

  WB analysis using 29510-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29510-1-AP (RASGRP4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

RASGRP4 Polyclonal Antibody for WB, ELISA

Cat No. 29510-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

RAS guanyl releasing protein 4

---

Tested Applications

• Positive WB detected in: Daudi cells, K-562 cells, Raji cells, Ramos cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29510-1-AP targets RASGRP4 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31219

  Product name: Recombinant human RASGRP4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 108-170 aa of BC146669

  Sequence: KATGDTQELRRLQICHLVRYWLMRHPEVMHQDPQLEEVIGRFWATVAREGNSAQRRLGDSSDL

• Full Name: RAS guanyl releasing protein 4
• Calculated Molecular Weight: 673 aa, 75 kDa
• Observed Molecular Weight: 54-75 kDa
• GenBank Accession Number: BC146669
• Gene Symbol: RASGRP4
• Gene ID (NCBI): 115727
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TDF6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RASGRP4 is a member of the RAS guanine nucleotide-releasing protein (RASGRP) family, which are crucial guanine nucleotide exchange factors (GEFs). The primary function of this family is to act as molecular switches that activate RAS signaling pathways by promoting the exchange of GDP for GTP on small GTPases. Specifically, RASGRP4 is highly and preferentially expressed in mast cells. It plays a vital role in the development, maturation, and functional activation of these immune cells by regulating key signaling cascades, such as the MAPK pathway.