Product Information
21219-1-AP targets RASSF1 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15652 Product name: Recombinant human RASSF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 210-272 aa of BC110412 Sequence: LPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERAERHGQVYLRKLLDDEQPLRL Predict reactive species |
| Full Name | Ras association (RalGDS/AF-6) domain family member 1 |
| Calculated Molecular Weight | 344 aa, 39 kDa |
| GenBank Accession Number | BC110412 |
| Gene Symbol | RASSF1 |
| Gene ID (NCBI) | 11186 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NS23 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |

