Product Information
21219-1-AP targets RASSF1 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15652 Product name: Recombinant human RASSF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 210-272 aa of BC110412 Sequence: LPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERAERHGQVYLRKLLDDEQPLRL Predict reactive species |
| Full Name | Ras association (RalGDS/AF-6) domain family member 1 |
| Calculated Molecular Weight | 344 aa, 39 kDa |
| GenBank Accession Number | BC110412 |
| Gene Symbol | RASSF1 |
| Gene ID (NCBI) | 11186 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NS23 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
What published studies show
The RASSF1 Polyclonal antibody (Cat# 21219-1-AP) has 1 total citation. It appears in Cancer Management Research (Impact Factor 2.6), published in February 2020. The cited study investigated how CircHIPK3 promotes gemcitabine resistance in pancreatic cancer cells by sponging miR-330-5p and targeting RASSF1. The research field is oncology, specifically pancreatic cancer drug resistance mechanisms involving lncRNA/miRNA regulation. The antibody was used in Western Blot with human samples.
| Species | Application | Title |
|---|---|---|
